DATASHEET RAA210925 FN9352 Rev.1.00 May 31, 2019 Pin-Configurable Dual 25A DC/DC Power Module with PMBus Interface The RAA210925 is a pin-strap configurable dual 25A step-down PMBus-compliant DC/DC power supply module that integrates a digital PWM controller, synchronous MOSFETs, power inductor, and passive components. Only input and output capacitors are needed to finish the design. Because of its thermally-enhanced HDA packaging technology, the module can deliver up to 25A of continuous output current without the need for airflow or additional heat sinking. The RAA210925 simplifies configuration and control of Renesas digital power technology while offering an upgrade to full PMBus configuration through the pin-compatible ISL8274M. Operating across an input voltage range of 4.5V to 14V, the RAA210925 offers adjustable output voltages down to 0.6V and achieves up to 95.5% conversion efficiencies. A unique ChargeModeTM control architecture provides a single clock cycle response to an output load step and can support switching frequencies up to 1067kHz. The power module integrates all power and most passive components and requires only a few external components to operate. The RAA210925 comes with a preprogrammed configuration for operating in Pin-strap mode. Output voltage, switching frequency, input UVLO, soft-start/stop delay and ramp times, tracking function, and the device SMBus address can be programmed with external pin-strap resistors. A standard PMBus interface addresses fault management, as well as real-time full telemetry and point-of-load monitoring. The RAA210925 is supported by PowerNavigatorTM software, a Graphical User Interface (GUI), that can configure modules for desired solutions. The RAA210925 is available in a low profile, compact 18mmx23mmx7.5mm fully encapsulated, thermally enhanced HDA package. Features * 25A/25A dual-channel output current * 4.5V to 14V single rail input voltage * Up to 95.5% efficiency * Programmable output voltage * 0.6V to 5V output voltage settings * 1.2% accuracy over line/load/temperature * ChargeMode control loop architecture * 296kHz to 1067kHz fixed switching frequency operations * No compensation required * Fast single clock cycle transient response * PMBus interface and/or pin-strap mode * Programmable through PMBus * Pin-strap mode for standard settings * Real-time telemetry for VIN, VOUT, IOUT, temperature, duty cycle, and fSW * Complete over/undervoltage, current, and temperature protections with fault logging * PowerNavigator supported * Thermally enhanced 18mmx23mmx7.5mm HDA package Applications * Server, telecom, storage, and datacom * Industrial/ATE and networking equipment * General purpose power for ASIC, FPGA, DSP, and memory Related Literature For a full list of related documents, visit our website: * RAA210925 device page FN9352 Rev.1.00 May 31, 2019 Page 1 of 64 RAA210925 VIN VDD ENABLE1 ENABLE2 10F VOUT1 VSENP1 VIN CIN 10F VSENN1 EN1 EN2 VR5 VR6 VDRV VOUT2 VSENP2 RAA210925 VCC VDRV1 2x10F VR VR55 SGND PGND VSENN2 SCL SDA VOUT1 COUT1 VOUT2 18 COUT2 PMBus Interface 2 3m m mm 7.5mm SA Note: This figure represents a typical implementation of the RAA210925. For PMBus operation, it is recommended to tie the enable pin (EN) to SGND. Figure 1. Application Circuit FN9352 Rev.1.00 May 31, 2019 Figure 2. Small Package for High Power Density Page 2 of 64 RAA210925 Contents 1. Overview . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 1.1 1.2 1.3 1.4 1.5 2. Typical Application Circuit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 5 RAA210925 Internal Block Diagram . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 8 Ordering Information . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 9 Pin Configuration . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 10 Pin Descriptions. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11 Specifications. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 2.1 2.2 2.3 2.4 3. Absolute Maximum Ratings . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Thermal Information. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Recommended Operation Conditions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Electrical Specifications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13 13 14 14 Typical Performance Curves. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 3.1 3.2 3.3 3.4 4. Efficiency Performance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Startup and Shutdown . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Derating Curves. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Transient Response Performance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 17 18 19 21 Functional Description . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 4.1 4.2 4.3 4.4 4.5 4.6 4.7 4.8 4.9 4.10 4.11 4.12 4.13 4.14 4.15 5. SMBus Communications . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Output Voltage Selection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Soft-Start, Stop Delay, and Ramp Times . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Voltage Tracking . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Power-Good. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Switching Frequency and PLL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Output Overcurrent Protection. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Loop Compensation. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . SMBus Module Address Selection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Output Overvoltage Protection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Output Prebias Protection . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Thermal Overload Protection. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Phase Spreading . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Monitoring Using SMBus . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Snapshot Parameter Capture . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 22 22 24 26 27 27 29 29 30 31 31 32 33 34 34 Layout Guide . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 35 5.1 5.2 5.3 5.4 5.5 5.6 Thermal Considerations. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Package Description . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . PCB Layout Pattern Design. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Thermal Vias . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Stencil Pattern Design . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . Reflow Parameters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . FN9352 Rev.1.00 May 31, 2019 36 36 36 36 36 37 Page 3 of 64 RAA210925 6. PMBus Command Summary. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38 6.1 6.2 PMBus Data Formats. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 PMBus Use Guidelines . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 40 7. PMBus Commands Description . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41 8. Revision History. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 8.1 8.2 9. Firmware . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 Datasheet . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56 Package Outline Drawing . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57 FN9352 Rev.1.00 May 31, 2019 Page 4 of 64 RAA210925 Overview Typical Application Circuit 3LQ6WUDS5HVLVWRUV (Note 2) (1 (1 (Note 1) N N $6&5 $6&5 &)* 5 5 5 96(7B),1( 6'$ 5 96(7B),1( 6&/ 5 6<1&2&3 6&/ 6'$ 5 5 5 6675$&. 5 6$89/2 5 5 96(7B&56 5 96(7B&56 9$8;RU9&&9WR9 6KRXOGEHDFWLYHEHIRUHHQDEOH 3* 3* 975.3 975.1 1.1 (1 (1 3* 3* 975.3 975.1 1. 1. Overview [) &HUDPLF [) 326&$3 9287 9$ 9287 9,1 9WR9 [) %XON & [)[) &HUDPLF & & & 9,1 5$$ 95 (Note 3) ) & & 96(11 96(13 95 [) &HUDPLF 9'59 9&& ) ) & & 5 9'' ) ) & [) 326&$3 9287 9$ 9287 9&& 9'59 & 96(11 96(13 95 95 6:' 6: 6:' 6: 3*1' 6*1' & 5 Notes: 1. R1 and R2 are not required if the PMBus host already has I2C pull-up resistors. 2. R3 through R11 can be selected according to the tables for the pin-strap resistor setting in this document. 3. V25, VR, and VR55 do not need external capacitors. V25 can be no connection. Figure 3. RAA210925 Digital PMBus Module Dual 25A/25A Application with Pin-Strap Settings FN9352 Rev.1.00 May 31, 2019 Page 5 of 64 Cout_Ceramic (F) (Note 4) ASCR Gain (Note 6) ASCR Residual Peak-to-Peak (Note 6) (mV) (Note 5) VOUT (V) fSW (kHz) IOUT (A) Avg OCP (A) CIN (F) 12 5 1067 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 6*100 275 100 170 12 5 615 20 25 2*470F POS + (8*22F + 4*47F) ceramic 1*470 6*100 175 80 150 12 3.3 800 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 8*100 300 90 150 12 3.3 571 20 25 2*470F POS + (8*22F + 4*47F) ceramic 1*470 8*100 175 80 140 12 2.5 1067 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 9*100 600 100 110 12 2.5 615 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 9*100 275 100 145 12 2.5 471 20 25 2*470F POS + (8*22F + 4*47F) ceramic 1*470 9*100 175 90 100 12 1.8 889 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 600 100 90 12 1.8 421 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 225 90 140 12 1.8 364 20 25 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 175 90 140 12 1.5 889 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 525 90 90 12 1.5 421 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 225 90 135 12 1.5 320 20 25 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 140 90 100 12 1.2 727 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 600 110 70 12 1.2 296 25 30 2*470F POS + (8*22F + 4*47F) ceramic 4*470 12*100 225 80 90 12 1 615 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 450 110 80 12 1 296 25 30 2*470F POS + (8*22F + 4*47F) ceramic 5*470 12*100 250 80 50 12 0.6 296 25 30 2*470F POS + (8*22F + 4*47F) ceramic 7*470 12*100 300 90 50 5 2.5 1067 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 9*100 600 100 90 5 2.5 615 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 9*100 275 100 130 5 2.5 471 20 25 2*470F POS + (8*22F + 4*47F) ceramic 1*470 9*100 175 90 140 5 1.8 889 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 600 100 85 5 1.8 421 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 250 100 120 5 1.8 364 20 25 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 200 100 135 5 1.5 889 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 525 90 90 5 1.5 421 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 250 100 125 5 1.5 320 20 25 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 140 90 150 5 1.2 727 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 600 110 90 1. Overview Page 6 of 64 VIN (V) Cout_Bulk (F) (Note 4) RAA210925 FN9352 Rev.1.00 May 31, 2019 Table 1. RAA210925 Design Guide Matrix and Output Voltage Response Cout_Ceramic (F) (Note 4) ASCR Gain (Note 6) ASCR Residual Peak-to-Peak (Note 6) (mV) (Note 5) VIN (V) VOUT (V) fSW (kHz) IOUT (A) Avg OCP (A) CIN (F) Cout_Bulk (F) (Note 4) 5 1.2 296 25 30 2*470F POS + (8*22F + 4*47F) ceramic 4*470 12*100 250 80 80 5 1 615 25 30 2*470F POS + (8*22F + 4*47F) ceramic 1*470 12*100 450 110 100 5 1 296 25 30 2*470F POS + (8*22F + 4*47F) ceramic 5*470 12*100 250 80 75 5 0.6 296 25 30 2*470F POS + (8*22F + 4*47F) ceramic 7*470 12*100 300 90 50 RAA210925 FN9352 Rev.1.00 May 31, 2019 Table 1. RAA210925 Design Guide Matrix and Output Voltage Response (Continued) Notes: 4. 100F (GRM31CD80J107ME39L) ceramic and 470F (6TPF470MAH) are selected for output capacitor in the evaluation board. 5. Peak-to-peak VOUT deviation is measured under 0%-60% load transient with 15A/s load step slew rate. 6. ASCR gain and residual was designed to achieve 50 phase margin at room temperature. 7. Frequency is selected to achieve the highest efficiency at full load as well as avoid saturation of the inductor. For instance, select 615kHz instead of 296kHz if 1V, 26A is required to avoid inductor saturation. Although better efficiency is obtained at 296kHz supporting 1V, 25A, higher frequency can be selected because less output capacitance is required to meet the transient response specification. 1. Overview Page 7 of 64 RAA210925 9'59 9'59 9&& 9,1 95 95 9 95 95 RAA210925 Internal Block Diagram 9'' 1.2 1. Overview /'2 2989 2787 2&8& 6:' + 9287 /RJLF 96(7B),1( 6: /'2V 9'59 ,QWHUOHDYH 3RZHU0DQDJHPHQW 3*1' 66 $6&5 96(7B&56 6675$&. (1 3* 9'59 9,1 )LOWHU 6QDSVKRW 6<1& 287 6<1& 2&3 3:0 3// '3:0 3:0 &KDUJH0RGH &RQWURO 6XSHUYLVRU 9,1 9'59 190 6:' 6: $'& + &6$ 9'59 $'& /RJLF 3URWHFWLRQ 9287 &6$ 3*1' $'& 9'' 96$ $'& ,QWHUQDO7HPS 6HQVRU 6&/ 6'$ 30%XV,& ,QWHUIDFH 96$ 96(13 6$89/2 96(11 6*1' : : 3*1' 6*1' 975.1 975.3 'LJLWDO&RQWUROOHU 9287 Figure 4. Internal Block Diagram FN9352 Rev.1.00 May 31, 2019 Page 8 of 64 RAA210925 1.3 1. Overview Ordering Information Part Number (Notes 9, 10) Part Marking Temp Range (C) Tape and Reel (Units) (Note 8) Package (RoHS Compliant) Pkg. Dwg. # RAA2109252GLG#AG0 RAA2109252 -40 to +85 - 58 Ld 18x23 HDA Module Y58.18x23 RAA2109252GLG#HG0 RAA2109252 -40 to +85 100 58 Ld 18x23 HDA Module Y58.18x23 RTKA2109252H00000BU Evaluation Board Notes: 8. Refer to TB347 for details about reel specifications. 9. These Pb-free plastic packaged products are RoHS compliant by EU exemption 7C-I and 7A. They employ special Pb-free material sets; molding compounds/die attach materials and NiPdAu plate-e4 termination finish, which is compatible with both SnPb and Pb-free soldering operations. Pb-free products are MSL classified at Pb-free peak reflow temperatures that meet or exceed the Pb-free requirements of IPC/JEDEC J STD-020. 10. For Moisture Sensitivity Level (MSL), see the RAA210925 device page. For more information about MSL, see TB363. Table 2. Key Differences Between Family of Parts Part Number Description VIN Range (V) VOUT Range (V) IOUT (A) RAA210925 25A/25A DC/DC dual channel Power Module 4.5 - 14 0.6 - 5 25/25 RAA210825 25A DC/DC single channel Power Module 4.5 - 14 0.6 - 5 25 RAA210833 33A DC/DC single channel Power Module 4.5 - 14 0.6 - 5 33 RAA210850 50A DC/DC single channel Power Module 4.5 - 14 0.6 - 5 50 RAA210870 70A DC/DC single channel Power Module 4.5 - 14 0.6 - 2.5 70 Table 3. Comparison of Simple Digital and Full Digital Parts ISL8274M RAA210925 VIN (V) 4.5 - 14 4.5 - 14 VOUT (V) 0.6 - 5 0.6 - 5 IOUT (Max) (A) 30/30 25/25 fSW (kHz) Digital PMBus Programmability for Configuration of Modules 296 - 1067 All PMBus commands. NVM access to store module configuration 296 - 1067 Configuration of modules supported by pin-strap resistors. Digital programmability supports configuration changes during run-time operation with a subset of PMBus commands. No NVM access to store module configuration Power Navigator Support Yes Yes SYNC Capability Yes Yes Current Sharing Multi-Modules No No DDC Pin (Inter-Device Communication) Yes No Note: For a full comparison of all the RAA210XXX and ISL827XM product offerings please visit the simple-digital module family page. FN9352 Rev.1.00 May 31, 2019 Page 9 of 64 RAA210925 1.4 1. Overview Pin Configuration 58 Ld HDA Top View 1 2 3 4 A 5 6 7 PAD1 B 8 9 ASCR2 VSET_ FINE1 18 EN2 VSEN2P EN1 PGND VSEN2N PAD6 PG2 PGND PAD7 PAD5 U 17 PAD2 SYNC/OCP VTRKP VSEN1N VSEN1P V25 SGND VDD SGND PGND VR5 VR SWD1 M T 16 CFG SDA PG1 VSET_FINE2 VTRKN L R 15 SA/UVLO K P 14 PAD4 PAD3 PGND PGND J N 13 SCL SS/TRACK E H 12 VOUT2 VSET_CRS2 VSET_CRS1 ASCR1 D G 11 VOUT1 C F 10 PGND VCC VR6 SGND VR55 PAD8 PGND VDRV VDRV SWD2 VDRV1 VDRV1 VIN PAD9 VIN PAD10 PGND PAD12 PAD11 VIN PGND V W PGND SW1 PGND SW2 Y AA PAD15 PAD13 AB AC FN9352 Rev.1.00 May 31, 2019 PAD14 PAD16 Page 10 of 64 RAA210925 1.5 1. Overview Pin Descriptions Pin Number Pin Name PAD1 VOUT1 PWR Power supply output voltage. Channel 1 provides an output voltage from 0.6V to 5V. Refer to the "Functional Description" on page 22 to set the maximum output current from these pads. PAD2 VOUT2 PWR Power supply output voltage. Channel 2 provides an output voltage from 0.6V to 5V. Refer to the "Functional Description" on page 22 to set the maximum output current from these pads. PAD3, PAD4, PAD5, PAD7, PAD10, PAD12, PAD13, PAD15 PGND PWR Power ground. Refer to the "Layout Guide" on page 35 for the PGND pad connections and I/O capacitor placement. Type Description PWR Signal ground. Refer to "Layout Guide" on page 35 for the SGND pad connections. PAD6 SGND PAD8, PAD9, PAD11 VIN PWR Input power supply voltage to power the module. Input voltage ranges from 4.5V to 14V. PAD14 SW1 PWR Switching node pads for Channel 1. The SW1 pad dissipates the heat and provides good thermal performance. Refer to "Layout Guide" on page 35 for the SW1 pad connections. PAD16 SW2 PWR Switching node pads for Channel 2. The SW2 pad dissipates the heat and provides good thermal performance. Refer to "Layout Guide" on page 35 for the SW2 pad connections. C5 VSET_CRS2 I Output voltage selection pin for Channel 2. Sets the VOUT2 set point and VOUT2 max. Use VSET_FINE2 for fine-tuning. C6 VSET_CRS1 I Output voltage selection pin for Channel 1. Sets the VOUT1 set point and VOUT1 max. Use VSET_FINE1 for fine-tuning. C7 ASCR2 I ChargeMode control ASCR parameters selection pin for Channel 2. Sets ASCR gain and residual values. C8 ASCR1 I ChargeMode control ASCR parameters selection pin for Channel 1. Sets ASCR gain and residual values. C9 VSET_FINE1 I Output voltage fine-tuning. Provides increased VOUT1 resolution based on programmed VSET_CRS1 value. C10 SA/UVLO I Serial address selection pin. Assigns unique address for each individual device or enables certain management features. This pin also sets the UVLO level. C11 CFG O Clock source configuration. If the clock source is internal, set the internal FREQUENCY_SWITCH according to the SYNC pin resistor setting. If the clock source is external, the internal FREQUENCY_SWITCH is set according to the CFG pin resistor. C12 SDA I/O Serial data. Connect to external host and/or to other Digital-DCTM devices. A pull-up resistor is required. C13 SCL I/O Serial clock. Connect to external host and/or to other Digital-DC devices. A pull-up resistor is required. D4 SS/ TRACK I Soft-start/stop selection pin. Sets the turn on/off delay and ramp time as well as tracking configuration. D5 PG1 O Power-good output for Channel 1. Power-good is configured as an open-drain output. D13 SYNC/ OCP I/O Clock synchronization input and OCP setting pin. Sets the frequency of the internal switch clock, synchronizes to an external clock, or an output internal clock. If using external synchronization, the external clock must be active before enable. Different OCP levels can be set with this pin. D14 EN2 I Enable pin for Channel 2. Logic high to enable the module output. E14 EN1 I Enable pin for Channel 1. Logic high to enable the module output. E4 VSET_FINE2 I/O E15 VSEN2P I FN9352 Rev.1.00 May 31, 2019 Output voltage fine-tuning. Provides increased VOUT2 resolution based on programmed VSET_CRS2 value. Differential output voltage sense feedback for Channel 2. Connect to positive output regulation point. Page 11 of 64 RAA210925 1. Overview Pin Number Pin Name Type F4 VTRKP I Tracking sense positive input. Tracks an external voltage source. F15 VSEN2N I Differential output voltage sense feedback for Channel 2. Connect to negative output regulation point. G4 VTRKN I Tracking sense negative input (return). G14 PG2 O Power-good output for Channel 2. Power-good is configured as an open-drain output. G15 V25 H3 VSEN1N I Differential output voltage sense feedback for Channel 1. Connect to a negative output regulation point. H4 VSEN1P I Differential output voltage sense feedback for Channel 1. Connect to a positive output regulation point. H16, J16, K16, M14 SGND K14 VDD L2 VR PWR Internal LDO bias pin. Tie VR to VR55 directly with a short loop trace. Not recommended to power external circuits. L3 SWD1 PWR Switching node driving pins for Channel 1. Directly connect to the SW1 pad with short loop wires. P11 SWD2 PWR Switching node driving pins for Channel 2. Directly connect to the SW2 pad with short loop wires. L14 VR5 PWR Internal 5V reference that powers internal circuitry. Place a 10F decoupling capacitor for this pin. Maximum external loading current is 5mA. PWR Internal LDO output. Connect VCC to VDRV for internal LDO driving. Description PWR Internal 2.5V reference that powers internal circuitry. No external capacitor required for this pin. Not recommended to power external circuits. PWR Signal grounds. Use multiple vias to connect the SGND pins to the internal SGND layer. PWR Input supply voltage for controller. Connect VDD pad to VIN supply. M1 VCC M5, M17, N5 PGND PWR Power grounds. Using multiple vias to connect the PGND pins to the internal PGND layer. M10 VR55 PWR Internal 5.5V bias voltage for internal LDO use only. Tie VR55 pin directly to the VR pin. Not recommended to power external circuits. M13 VR6 PWR Internal 6V reference that powers internal circuitry. Place a 10F decoupling capacitor for this pin. Not recommended to power external circuits. N6, N16 VDRV PWR Power supply for internal FET drivers. Connect a 10F bypass capacitor to each of these pins. These pins can be driven by the internal LDO through the VCC pin or by the external power supply directly. Keep the driving voltage between 4.5V and 5.5V. For 5V input application, use external supply or connect this pin to VIN. R8, R17 VDRV1 FN9352 Rev.1.00 May 31, 2019 I Bias pin of the internal FET drivers. Always tie to VDRV. Page 12 of 64 RAA210925 2. 2. Specifications Specifications 2.1 Absolute Maximum Ratings Parameter Minimum Maximum Unit Input Supply Voltage, VIN Pin -0.3 17 V Input Supply Voltage for Controller, VDD Pin -0.3 17 V MOSFET Switch Node Voltage, SW1/2, SWD1/2 (Note 11) -0.3 25 V MOSFET Driver Supply Voltage, VDRV, VDRV1 Pin -0.3 6.0 V Output Voltage, VOUT1/2 Pin -0.3 6.0 V Internal Reference Supply Voltage VR6 Pin -0.3 6.6 V VR, VR5, VR55 Pin -0.3 6.5 V V25 Pin -0.3 3 V Logic I/O Voltage for EN1/2, PG1/2, ASCR1/2, SA/UVLO, SCL, SDA, SYNC/OCP, SS/TRACK, VSET_CRS1/2, VSET_FINE1/2 -0.3 6.0 V VSEN1P, VSEN2P, VTRKP -0.3 6.0 V VSEN1N, VSEN2N, VTRKN -0.3 Analog Input Voltages ESD Rating 0.3 V Value Unit 2 kV Machine Model (Tested per JESD22-A115C) 200 V Charged Device Model (Tested per JS-002-2014) 750 V Latch-Up (Tested per JESD78E; Class 2, Level A) 100 mA Human Body Model (Tested per JS-001-2017) Note: 11. Do not apply DC voltage higher than 17V to the pins. CAUTION: Do not operate at or near the maximum ratings listed for extended periods of time. Exposure to such conditions may adversely impact product reliability and result in failures not covered by warranty. 2.2 Thermal Information Thermal Resistance (Typical) 58 Ld HDA Package (Notes 12, 13) JA (C/W) JC (C/W) 5.3 1.1 Notes: 12. JA is defined by simulation in free air with the module mounted on an 8-layer evaluation board 4.7x4.8inch in size with 2oz Cu on all layers. 13. For JC, the "case temp" location is the center of the package underside. Parameter Minimum Maximum Junction Temperature (Plastic Package) Storage Temperature Range Pb-Free Reflow Profile FN9352 Rev.1.00 May 31, 2019 -55 Maximum Unit +125 C +150 C see Figure 33 Page 13 of 64 RAA210925 2.3 2. Specifications Recommended Operation Conditions Minimum Maximum Unit Input Supply Voltage Range, VIN Parameter 4.5 14 V Input Supply Voltage Range for Controller, VDD 4.5 14 V Output Voltage Range, VOUT 0.6 5 V 0 25 A -40 +125 C Output Current Range, IOUT(DC) Per Channel (Note 16) Operating Junction Temperature Range, TJ 2.4 Electrical Specifications VIN = VDD = 12V, TA = -40C to +85C, unless otherwise noted. Typical values are at TA = +25C. Boldface limits apply across the operating temperature range, -40C to +85C. Parameter Symbol Test Conditions Min (Note 14) Typ Max (Note 14) Unit 40 50 mA 5.5 6.1 6.6 V 4.5 5.2 5.5 V 2.25 2.5 2.75 V Input and Supply Characteristics Input Supply Current for Controller IDD 6V Internal Reference Supply Voltage VR6 5V Internal Reference Supply VR5 2.5V Internal Reference Supply V25 Internal LDO Output Voltage VCC Internal LDO Output Current IVCC Input Supply Voltage for Controller Read Back Resolution VDD_READ_RES Input Supply Voltage for Controller Read Back Total Error (Note 17) VDD_READ_ERR VIN = VDD = 12V, VOUT = 0V, module not enabled IVR5 < 5mA 5.3 VIN = VDD = 12V, VCC connected to VDRV, module enabled V 50 PMBus read mA 20 mV 2 % FS Output Characteristics Output Voltage Adjustment Range VOUT_RANGE 0.54 Output Voltage Set-Point Resolution VOUT_RES Configured using PMBus Output Voltage Set-Point Accuracy (Notes 15, 17) VOUT_ACCY Includes line, load, and temperature (-20C TA +85C) VOUT_READ_RES Output Voltage Read Back Total Error (Note 17) VOUT_READ_ERR PMBus read IOUT_RANGE Per channel Output Current Read Back Total Error IOUT_READ_ERR 0.025 -1.2 1.2 -2 PMBus read at max load VOUT = 1.5V V %VOUT 0.15 Output Voltage Read Back Resolution Output Current Range (Note 16) 5.5 % % FS 2 % FS 25 A 3 A Soft-Start and Sequencing Delay Time from Enable to VOUT Rise tON_DELAY Accuracy FN9352 Rev.1.00 May 31, 2019 tON_DELAY tON_DELAY_ACCY Configured using pin-strap resistor or PMBus 2 300 2 ms ms Page 14 of 64 RAA210925 2. Specifications VIN = VDD = 12V, TA = -40C to +85C, unless otherwise noted. Typical values are at TA = +25C. Boldface limits apply across the operating temperature range, -40C to +85C. (Continued) Parameter Symbol Test Conditions Output Voltage Ramp-Up Time tON_RISE Configured using pin-strap resistor or PMBus Output Voltage Ramp-Up Time Accuracy tON_RISE_ACCY Delay Time from Disable to VOUT Fall tOFF_DELAY Accuracy tOFF_DELAY Min (Note 14) Typ 0.5 Max (Note 14) Unit 120 ms 250 Configured using pin-strap resistor or PMBus 2 Configured using pin-strap resistor or PMBus 0.5 tOFF_DELAY_ACCY s 300 ms 120 ms 2 ms Output Voltage Fall Time tOFF_FALL Output Voltage Fall Time Accuracy tON_FALL_ACCY 250 s VPG_DELAY 3 ms Power-Good Power-Good Delay Temperature Sense Temperature Sense Range TSENSE_RANGE Internal Temperature Sensor Accuracy INT_TEMPACCY Tested at +100C -50 150 C -5 5 C 4.18 16 V Fault Protection VDD Undervoltage Threshold Range VDD_UVLO_RANGE VDD Undervoltage Threshold Accuracy (Note 17) VDD_UVLO_ACCY 2 %FS VDD Undervoltage Response Time VDD_UVLO_DELAY 10 s VOUT Overvoltage Threshold Range VOUT_OV_RANGE 1.15VOUT V VOUT Undervoltage Threshold Range VOUT_UV_RANGE Factory default Configured using pin-strap resistor or PMBus VOUT_OV/UV_ACCY VOUT OV/UV Response Time VOUT_OV/UV_DELAY Output Current Limit Set-Point Accuracy (Note 17) ILIMIT_ACCY Over-temperature Protection Threshold (Controller Junction Temperature) TJUNCTION 0.85VOUT V V 0 0.95VOUT V -2 2 % Tested at IOUT_AVG_OC_FAULT_LIMIT = 35A Factory default Configured using PMBus VOUT_MAX 1.05VOUT Factory default Configured using pin-strap resistor or PMBus VOUT OV/UV Threshold Accuracy (Note 15) Thermal Protection Hysteresis Measured internally 10 s 10 % FS C 115 -40 115 C 15 TJUNCTION_HYS C Oscillator and Switching Characteristics Switching Frequency Range Switching Frequency Set-Point Accuracy FN9352 Rev.1.00 May 31, 2019 fSW_RANGE 296 1067 kHz fSW_ACCY -5 5 % Page 15 of 64 RAA210925 2. Specifications VIN = VDD = 12V, TA = -40C to +85C, unless otherwise noted. Typical values are at TA = +25C. Boldface limits apply across the operating temperature range, -40C to +85C. (Continued) Parameter Minimum Pulse Width Required from External SYNC Clock Drift Tolerance for External SYNC Clock Symbol EXT_SYNCPW EXT_SYNCDRIFT Test Conditions Min (Note 14) Typ Max (Note 14) Unit Measured at 50% amplitude 150 ns External SYNC clock equal to 500kHz is not supported -10 10 % EN1/2, PG1/2, SA/UVLO, SCL, SDA, ASCR1/2, SS/TRACK, SYNC/OCP, VSET_CRS1/2, VSET_FINE1/2 -100 +100 nA 0.8 V Logic Input/Output Characteristics Bias Current at the Logic Input Pins ILOGIC_BIAS Logic Input Low Threshold Voltage VLOGIC_IN_LOW Logic Input High Threshold Voltage VLOGIC_IN_HIGH Logic Output Low Threshold Voltage VLOGIC_OUT_LOW 2mA sinking Logic Output High Threshold Voltage VLOGIC_OUT_HIGH 2mA sourcing 2.0 V 0.5 2.25 V V PMBus Interface Timing Characteristic PMBus Operating Frequency fSMB 100 400 kHz Notes: 14. Compliance to datasheet limits is assured by one or more methods: Production test, characterization, and/or design. Controller is independently tested before module assembly. 15. VOUT measured at the termination of the VSEN1/2P and VSEN1/2N sense points. 16. The MAX load current is determined by the thermal "Derating Curves" on page 19. 17. "FS" stands for full scale of recommended maximum operation range. FN9352 Rev.1.00 May 31, 2019 Page 16 of 64 RAA210925 3. 3. Typical Performance Curves Typical Performance Curves 3.1 Efficiency Performance Operating condition: TA = +25C, no air flow. COUT = 1 x 470F POSCAP + 12 x 100F Ceramic. Typical values are used unless otherwise noted. The efficiency curves were measured on the evaluation board. For test conditions, refer to Table 1 on page 6. 95 12VIN 12VIN 90 90 85 85 Efficiency (%) Efficiency (%) 95 80 75 0.6V_296kHz 1.2V_727kHz 1.8V_889kHz 70 1V_615kHz 1.5V_889kHz 2.5V_1067kHz 5 10 15 20 75 70 0 5 95 12VIN 10 15 20 25 5VIN 90 90 Efficiency (%) Efficiency (%) 3.3V_800kHz Figure 6. Single Channel Efficiency vs Output Current 100 85 80 75 70 85 80 75 1.5V_320kHz 1.8V_364kHz 0.6V_296kHz 1V_615kHz 2.5V_471kHz 3.3V_571kHz 1.2V_727kHz 1.5V_889kHz 1.8V_889kHz 2.5V_1067kHz 70 5V_615kHz 65 65 0 5 10 15 0 20 5 10 15 20 25 Load Current (A) Load Current (A) Figure 7. Single Channel Efficiency vs Output Current Figure 8. Single Channel Efficiency vs Output Current 100 5VIN 5VIN 95 90 85 Efficiency (%) Efficiency (%) 1.8V_421kHz 2.5V_615kHz Load Current (A) Figure 5. Single Channel Efficiency vs Output Current 95 1.2V_296kHz 1.5V_421kHz 65 25 Load Current (A) 95 1V_296kHz 5V_1067kHz 65 0 80 80 75 70 1V_296kHz 1.2V_296kHz 1.5V_421kHz 1.8V_421kHz 2.5V_615kHz 3.3V_800kHz 65 90 85 80 75 1.5V_320kHz 1.8V_364kHz 70 2.5V_471kHz 3.3V_571kHz 65 0 5 10 15 20 25 Load Current (A) Figure 9. Single Channel Efficiency vs Output Current FN9352 Rev.1.00 May 31, 2019 0 5 10 15 20 Load Current (A) Figure 10. Single Channel Efficiency vs Output Current Page 17 of 64 RAA210925 3.2 3. Typical Performance Curves Startup and Shutdown Operating condition: TA = +25C, no air flow. COUT = 1 x 470F POSCAP + 12 x 100F Ceramic. Typical values are used unless otherwise noted. SW (10V/Div) SW (10V/Div) IOUT (16A/Div) IOUT (16A/Div) VOUT (750mV/Div) VOUT (750mV/Div) PG (5V/Div) PG (5V/Div) 2ms/Div 2ms/Div Figure 11. Single Channel Startup 12VIN, 1.5VOUT, 25A Figure 12. Single Channel Startup 12VIN, 1.5VOUT, 0A SW (10V/Div) SW (10V/Div) IOUT (16A/Div) IOUT (16A/Div) VOUT (750mV/Div) VOUT (750mV/Div) PG (5V/Div) PG (5V/Div) 100s/Div 1s/Div Figure 13. Single Channel Shutdown 12VIN, 1.5VOUT, 25A Figure 14. Single Channel Shutdown 12VIN, 1.5VOUT, 0A FN9352 Rev.1.00 May 31, 2019 Page 18 of 64 RAA210925 3.3 3. Typical Performance Curves Derating Curves All of the following curves were plotted at TJ = +125C. The derating curves were measured on the evaluation board. For test conditions, refer to Table 1 on page 6. Load current is applied per channel, two channels are operating at the same time. 30 30 fSW = 615kHz fSW = 615kHz 25 Load Current (A) Load Current (A) 25 20 15 10 20 15 10 0LFM 200LFM 400LFM 5 0LFM 200LFM 400LFM 5 0 0 25 45 65 85 105 125 25 45 Ambient Temperature (C) Figure 15. 12VIN to 1VOUT 30 85 30 fSW = 296kHz fSW = 296kHz Load Current (A) 25 20 15 10 0LFM 200LFM 400LFM 5 20 15 10 0LFM 200LFM 400LFM 5 0 0 25 45 65 85 105 125 25 45 Ambient Temperature (C) 65 85 105 125 Ambient Temperature (C) Figure 18. 5VIN to 1VOUT Figure 17. 12VIN to 1VOUT 30 30 fSW = 889kHz fSW = 889kHz 25 Load Current (A) 25 Load Current (A) 125 105 Figure 16. 5VIN to 1VOUT 25 Load Current (A) 65 Ambient Temperature (C) 20 15 10 0LFM 200LFM 400LFM 5 20 15 10 0LFM 200LFM 400LFM 5 0 0 25 45 65 85 Ambient Temperature (C) Figure 19. 12VIN to 1.5VOUT FN9352 Rev.1.00 May 31, 2019 105 125 25 45 65 85 105 125 Ambient Temperature (C) Figure 20. 5VIN to 1.5VOUT Page 19 of 64 RAA210925 3. Typical Performance Curves All of the following curves were plotted at TJ = +125C. The derating curves were measured on the evaluation board. For test conditions, refer to Table 1 on page 6. Load current is applied per channel, two channels are operating at the same time. (Continued) 30 30 fSW = 1067kHz fSW = 615kHz 25 Load Current (A) Load Current (A) 25 20 15 10 20 15 10 0LFM 200LFM 400LFM 5 0 0 25 45 0LFM 200LFM 400LFM 5 65 85 105 25 125 45 65 85 105 125 Ambient Temperature (C) Ambient Temperature (C) Figure 21. 12VIN to 2.5VOUT Figure 22. 5VIN to 2.5VOUT 30 fSW = 1067kHz Load Current (A) 25 20 15 10 0LFM 200LFM 5 400LFM 0 25 45 65 85 105 125 Ambient Temperature (C) Figure 23. 12VIN to 5VOUT FN9352 Rev.1.00 May 31, 2019 Page 20 of 64 RAA210925 3.4 3. Typical Performance Curves Transient Response Performance Operating condition: TA = +25C, no air flow. Refer to Table 1 on page 6 for output capacitor and ASCR settings. Typical values are used unless otherwise noted. IOUT (5A/Div) IOUT (5A/Div) VOUT (50mV/Div) VOUT (50mV/Div) 50s/Div Figure 24. 0A-15A, 15A/s, 12VIN,1VOUT, 615kHz 50s/Div Figure 25. 0A-15A, 15A/s, 12VIN,1.5VOUT, 889kHz IOUT (5A/Div) IOUT (5A/Div) VOUT (50mV/Div) VOUT (50mV/Div) 50s/Div 50s/Div Figure 26. 0A-15A, 15A/s, 12VIN,1.8VOUT, 889kHz Figure 27. 0A-15A, 15A/s, 12VIN, 2.5VOUT, 1067kHz IOUT (5A/Div) IOUT (5A/Div) VOUT (50mV/Div) VOUT (50mV/Div) 50s/Div 50s/Div Figure 28. 0A-12.5A, 15A/s, 12VIN, 3.3VOUT, 800kHz Figure 29. 0A-12.5A, 15A/s, 12VIN, 5VOUT, 1067kHz FN9352 Rev.1.00 May 31, 2019 Page 21 of 64 RAA210925 4. 4. Functional Description Functional Description 4.1 SMBus Communications The RAA210925 provides a SMBus digital interface that enables the user to configure the module operation as well as monitor the input and output parameters. The RAA210925 can be used with any SMBus host device. In addition, the module is compatible with PMBus Power System Management Protocol Specification Parts I and II version 1.2. The RAA210925 accepts most standard PMBus commands. When configuring the device using PMBus commands, it is recommended that the enable pin is tied to SGND. The SMBus device address is the only parameter that must be set by the external pins. The RAA210925 can operate without the PMBus in pin-strap mode with configurations programmed by pin-strap resistors, such as output voltage, ASCR setting, switching frequency, OCP limit, device SMBus address, input UVLO, soft-start/stop, and tracking. 4.2 Output Voltage Selection The output voltages of both channels may be set to a voltage between 0.6V and 5V if the input voltage is higher than the desired output voltage by an amount sufficient to maintain regulation. The VSET_CRS1/2 (VOUT Coarse) and VSET_FINE1/2 (VOUT Fine) pins set the output voltage. A standard 1% resistor is required. Placing a resistor between VCRS1/2 and SGND based on Table 4 determines the VCRS value. If higher resolution is desired, the VSET_FINE pin can be used to fine-tune the output voltage settings according to the following command set: VOUT_COMMAND = VOUT_CRS + 5mV * N, if 0.6V VOUT_CRS < 1.4V VOUT_CRS + 10mV * N, if 1.4V VOUT_CRS < 2V VOUT_CRS + 50mV * N, if 2V VOUT_CRS < 3.6V VOUT_CRS + 100mV * N, if 3.6V VOUT_CRS < 5V VOUT_CRS, if VOUT_CRS = 5V Use the resistors values from Table 5 on page 23 to set the appropriate value of N for calculating the final output voltage. Table 4. Output Voltage Resistor Settings FN9352 Rev.1.00 May 31, 2019 VOUT_CRS1/2 (V) RSET1/2 (k) 1 LOW 1.5 OPEN 3.3 HIGH 0.6 10 0.675 11 0.7 12.1 0.72 13.3 0.75 14.7 0.8 16.2 0.85 17.8 0.9 19.6 0.93 21.5 0.95 23.7 0.98 26.1 1.03 28.7 Page 22 of 64 RAA210925 4. Functional Description Table 4. Output Voltage Resistor Settings (Continued) VOUT_CRS1/2 (V) RSET1/2 (k) 1.05 31.6 1.1 34.8 1.12 38.3 1.15 42.2 1.2 46.4 1.25 51.1 1.3 56.2 1.35 61.9 1.4 68.1 1.65 75 1.8 82.5 1.85 90.9 2 100 2.4 110 2.5 121 2.8 133 3 147 3.6 162 5 178 Table 5. VSET_FINE Settings FN9352 Rev.1.00 May 31, 2019 N RSET1/2 (k) 0 10, or OPEN 1 11 2 12.1 3 13.3 4 14.7 5 16.2 6 17.8 7 19.6 8 21.5 9 23.7, or connect to SGND 10 26.1 11 28.7 12 31.6 13 34.8 14 38.3 15 42.2 16 46.4 17 51.1 18 56.2 Page 23 of 64 RAA210925 4. Functional Description Table 5. VSET_FINE Settings (Continued) N RSET1/2 (k) 19 61.9 20 68.1, or connect to V25 The output voltage may also be set to any value between 0.6V and 5V using the PMBus command VOUT_COMMAND. By default, VOUT_MAX is set to 110% of VOUT set by the pin-strap resistor, which can be changed to any value up to 5.5V by the PMBus Command VOUT_MAX. 4.3 Soft-Start, Stop Delay, and Ramp Times The RAA210925 follows an internal start-up procedure after power is applied to the VDD pin. The module requires approximately 60ms to 70ms to check for specific values stored in its internal memory and programmed by pin-strap resistors. When this process is completed, the device is ready to accept commands through the PMBus interface and the module is ready to be enabled. If the module is to be synchronized to an external clock source, the clock frequency must be stable before asserting the EN pin. It may be necessary to set a delay from when an enable signal is received until the output voltage starts to ramp to its target value. In addition, the designer may wish to precisely set the time required for VOUT to ramp to its target value after the delay period has expired. These features can be used as part of an overall inrush current management strategy or to precisely control how fast a load IC is turned on. The RAA210925 gives the system designer several options for precisely and independently controlling both the delay and ramp time periods. The soft-start delay period begins when the EN pin is asserted and ends when the delay time expires. The soft-start delay (TON_DELAY) and ramp-up time (TON_RISE) can be set to custom values with pin-strap resistors or PMBus. When the delay time is set to 0ms, the device begins its ramp-up after the internal circuitry has initialized (approximately 2ms). When the soft-start ramp period is set to 0ms, the output ramps up as quickly as the output load capacitance and loop settings allow. It is generally recommended to set the soft-start ramp to a value greater than 2ms to prevent inadvertent fault conditions due to excessive inrush current. Similar to the soft-start delay and ramp-up time, the delay (TOFF_DELAY) and ramp-down time (TOFF_FALL) for soft-stop/off can be set to custom values with pin-strap resistors or PMBus. In addition, the module can be configured as "immediate off" using the command ON_OFF_CONFIG, so that the internal MOSFETs are turned off immediately after the delay time expires. The SS/TRACK pin can be used to program the soft-start/stop delay time and ramp time to some typical values as well as enable/disable the tracking function shown in Table 6 on page 24. Table 6. Soft-Start/Stop and Tracking Resistor Settings TON_DELAY TOFF_DELAY (ms) TON_RISE TOFF_FALL (ms) Tracking Ch1 Ch2 Ch1 Ch2 Ch1 5 5 2 2 No No LOW 5 5 2 5 No No OPEN 5 5 5 2 No No HIGH 5 5 5 5 No No 10 5 10 2 2 No No 11 5 10 2 5 No No 12.1 5 10 5 2 No No 13.3 5 10 5 5 No No 14.7 10 5 2 2 No No 16.2 FN9352 Rev.1.00 May 31, 2019 Ch2 R (k) Page 24 of 64 RAA210925 4. Functional Description Table 6. Soft-Start/Stop and Tracking Resistor Settings (Continued) TON_DELAY TOFF_DELAY (ms) TON_RISE TOFF_FALL (ms) Tracking Ch1 Ch2 Ch1 Ch2 Ch1 Ch2 R (k) 10 5 2 5 No No 17.8 10 5 5 2 No No 19.6 10 5 5 5 No No 21.5 20 5 2 2 No No 23.7 20 5 5 5 No No 26.1 5 20 2 2 No No 28.7 5 20 2 5 No No 31.6 5 20 5 2 No No 34.8 5 20 5 5 No No 38.3 5 N/A 2 N/A No Track 100% 42.2 5 N/A 2 N/A No Track 50% 46.4 5 N/A 5 N/A No Track 100% 51.1 5 N/A 5 N/A No Track 50% 56.2 10 N/A 2 N/A No Track 100% 61.9 10 N/A 2 N/A No Track 50% 68.1 10 N/A 5 N/A No Track 100% 75 10 N/A 5 N/A No Track 50% 82.5 N/A 5 N/A 2 Track 100% No 90.9 N/A 5 N/A 2 Track 50% No 100 N/A 5 N/A 5 Track 100% No 110 N/A 5 N/A 5 Track 50% No 121 N/A 10 N/A 2 Track 100% No 133 N/A 10 N/A 2 Track 50% No 147 N/A 10 N/A 5 Track 100% No 162 N/A 10 N/A 5 Track 50% No 178 FN9352 Rev.1.00 May 31, 2019 Page 25 of 64 RAA210925 4.4 4. Functional Description Voltage Tracking Numerous high performance systems place stringent demands on the order in which the power supply voltages are turned on. This is particularly true when powering FPGAs, ASICs, and other advanced processor devices that require multiple supply voltages to power a single die. In most cases, the I/O interface operates at a higher voltage than the core and therefore, the core supply voltage must not exceed the I/O supply voltage according to the manufacturers' specifications. The RAA210925 integrates a tracking scheme that allows one of its outputs (Channel 1 or Channel 2) to track a voltage that is applied to the VTRKP and VTRKN pins with no external components required. The VTRKP and VTRKN pins are analog inputs that, when the tracking mode is enabled, configure the voltage applied to the VTRKP and VTRKN pins to act as a reference for the device's output regulation. Figure 30 illustrates the typical connection and the two tracking modes: * Coincident - This mode configures the RAA210925 to ramp its output voltage at the same rate as the voltage applied to the VTRK pin until it reaches its desired output voltage. The device that is tracking another output voltage (slave) must be set to its desired steady-state output voltage. * Ratiometric - This mode configures the RAA210925 to ramp its output voltage at a rate that is a percentage of the voltage applied to the VTRKP and VTRKN pins. The device that is tracking another output voltage (slave) must be set to its desired steady-state output voltage. VIN VTRKN VTRKP RAA210 925 Q1 L1 Q2 Vo2 C1 Vo1 VOUT Vo1 Vo2 Tim e Coincident VOUT Vo1 Vo2 Tim e Ratiom etric Figure 30. Tracking Modes The master RAA210925 device in a tracking group is defined as the device that has the highest target output voltage within the group. This master device controls the ramp rate of all tracking devices and is not configured for tracking mode. The maximum tracking rise time is 1V/ms. The slave device must be enabled before the master. FN9352 Rev.1.00 May 31, 2019 Page 26 of 64 RAA210925 4. Functional Description Any device that is configured for tracking mode ignores its TON_DELAY and TON_RISE settings and its output takes on the turn-on/turn-off characteristics of the reference voltage present at the VTRKP and VTRKN pins. The VOUT_COMMAND needs to be set the same as the target tracking voltage when tracking is enabled. For example, the VOUT_COMMAND of the Page1 (VOUT2 which enables the tracking) needs to set to 1V if tracking 100% is selected and a ramp of 1V is applied to VTRKP and VTRKN. The VOUT_COMMAND of Page 1 (VOUT2 which enables the tracking) needs to set to 1V if tracking 50% is selected and a ramp of 2V is applied to VTRKP and VTRKN. In Tracking mode, the minimum voltage that can be tracked is ~200mV. 4.5 Power-Good The RAA210925 provides a Power-Good (PG) signal that indicates the output voltage is within a specified tolerance of its target level and no fault condition exists. By default, the PG pin asserts if the output is within 10% of the target voltage. This limit may be changed using the PMBus command POWER_GOOD_ON. A PG delay period is defined as the time from when all conditions within the RAA210925 for asserting PG are met to when the PG pin is actually asserted. This feature is commonly used instead of using an external reset controller to control external digital logic. A fixed PG delay of 3ms is programmed for the RAA210925. 4.6 Switching Frequency and PLL The device's switching frequency is set from 296kHz to 1067kHz using the pin-strap method (combined with the average OCP limit setting) as shown in Table 7, or by using the PMBus command FREQUENCY_SWITCH. Table 7. Switching Frequency and OCP Limit Resistor Setting Switching Frequency OCP Avg R (k) fSW (kHz) Ch1 (A) Ch2 (A) LOW 296 35 35 OPEN 889 35 35 HIGH 1067 35 35 10 296 30 35 11 296 30 30 12.1 296 25 35 13.3 296 25 30 14.7 296 25 25 16.2 320 25 35 17.8 320 25 30 19.6 320 25 25 21.5 320 20 30 23.7 320 20 25 26.1 364 25 35 28.7 364 25 30 31.6 364 20 30 34.8 421 30 35 38.3 421 30 30 42.2 471 25 35 46.4 471 25 30 51.1 471 20 35 56.2 571 25 35 FN9352 Rev.1.00 May 31, 2019 Page 27 of 64 RAA210925 4. Functional Description Table 7. Switching Frequency and OCP Limit Resistor Setting (Continued) Switching Frequency OCP Avg R (k) fSW (kHz) Ch1 (A) Ch2 (A) 61.9 571 25 30 68.1 571 20 35 75 571 20 30 82.5 615 35 35 90.9 615 35 30 100 615 30 30 110 615 25 35 121 615 25 30 133 615 25 25 147 727 35 35 162 800 30 35 178 800 30 30 The RAA210925 incorporates an internal Phase-Locked Loop (PLL) to clock the internal circuitry. The PLL can be driven by an external clock source connected to the SYNC pin. This configuration can be achieved by connecting a resistor to the CFG pin. If the clock source is set to internal, the internal frequency is set according to the SYNC pin resistor settings. If the clock source is programmed to external, the internal frequency is set according to the resistor connected to the CFG pin as shown in Table 8. The external clock signal must not vary more than 10% from its initial value and should have a minimum pulse width of 150ns. For the external clock source, OCP AVG is 25A for CH1 and CH2, which is not adjustable. Table 8. External Frequency SYNC Settings Clock Source Internal FREQUENCY_SWITCH (kHz) RSET (k) Internal Determined by SYNC resistor 10, or OPEN External 296 11 External 340 12.1 External 390 13.3 External 444 14.7 External 516 16.2, or connect to SGND External 593 17.8 External 696 19.6 External 800 21.5 External 941 23.7 External 1067 26.1, or connect to V25 FN9352 Rev.1.00 May 31, 2019 Page 28 of 64 RAA210925 4.7 4. Functional Description Output Overcurrent Protection The RAA210925 is protected from damage if the output is shorted to ground or if an overload condition is imposed on the output. Average output overcurrent fault threshold can be programmed by the PMBus command IOUT_AVG_OC_FAULT_LIMIT while the peak output overcurrent fault threshold can be programmed by the PMBus command IOUT_OC_FAULT_LIMIT. The default response from an average overcurrent fault is an immediate shutdown with a continuous retry of 70ms delay. A hard bound of 50A is applied to the peak overcurrent limit. The average OCP limit can be set by the SYNC/OCP pin strap. Refer to Table 7 on page 27 for more information. 4.8 Loop Compensation The module loop response can be set by using the pin-strap method (ASCR1/2 pins) according to Table 9 or through the PMBus command ASCR_CONFIG. The RAA210925 uses the ChargeMode control algorithm that responds to the output current changes within a single PWM switching cycle, achieving a smaller total output voltage variation with less output capacitance than traditional PWM controllers. Table 9. ASCR Resistor Setting ASCR Gain ASCR Residual R (k) 350 110 LOW 525 90 OPEN 475 80 HIGH 100 90 10 100 100 11 120 90 12.1 120 100 13.3 140 90 14.7 140 100 16.2 140 110 17.8 150 90 19.6 150 100 21.5 160 70 23.7 160 90 26.1 175 80 28.7 175 90 31.6 200 90 34.8 200 100 38.3 200 110 42.2 225 80 46.4 225 90 51.1 250 80 56.2 250 100 61.9 275 90 68.1 275 100 75 300 70 82.5 300 90 90.9 350 100 100 FN9352 Rev.1.00 May 31, 2019 Page 29 of 64 RAA210925 4. Functional Description Table 9. ASCR Resistor Setting (Continued) 4.9 ASCR Gain ASCR Residual R (k) 450 100 110 450 110 121 500 70 133 500 90 147 600 100 162 600 110 178 SMBus Module Address Selection Each module must have its own unique serial address to distinguish between other devices on the bus. The module address is set by connecting a resistor between pins SA/UVLO and SGND. The SA/UVLO pin also defines the input undervoltage lockout limit. The input Undervoltge Lockout (UVLO) prevents the RAA210925 from operating when the input falls below a preset threshold, indicating the input supply is out of its specified range. The UVLO threshold (VUVLO) can be set between 4.18V and 16V by using the PMBus command VIN_UV_FAULT_LIMIT. Table 10 lists the available module addresses. A standard 1% resistor is required. When the UVLO threshold is hit, the module shuts down immediately. The fault needs to be cleared for the module to restart. Table 10. SMBus Address and UVLO Resistor Setting PMBus Address UVLO (V) 26h 4.2 LOW 28h 4.5 OPEN 19h 10.8 10 1Ah 10.8 11 FN9352 Rev.1.00 May 31, 2019 R (k) 1Bh 10.8 12.1 1Ch 10.8 13.3 1Dh 10.8 14.7 1Eh 10.8 16.2 1Fh 10.8 17.8 20h 4.2 19.6 21h 4.2 21.5 22h 4.2 23.7 23h 4.2 26.1 24h 4.2 28.7 25h 4.2 31.6 26h 4.2 34.8 27h 4.2 38.3 28h 4.5 42.2 29h 4.5 46.4 2Ah 4.5 51.1 2Bh 4.5 56.2 2Ch 4.5 61.9 2Dh 4.5 68.1 2Eh 4.5 75 Page 30 of 64 RAA210925 4. Functional Description Table 10. SMBus Address and UVLO Resistor Setting (Continued) 4.10 PMBus Address UVLO (V) R (k) 2Fh 4.5 82.5 30h 10.8 90.9 31h 10.8 100 32h 10.8 110 33h 10.8 121 34h 10.8 133 35h 10.8 147 36h 10.8 162 37h 10.8 178 Output Overvoltage Protection The RAA210925 offers an internal output overvoltage protection circuit that can be used to protect sensitive load circuitry from being subjected to a voltage higher than its prescribed limits. A hardware comparator compares the actual output voltage (seen at pins VSEN1/2P, VSEN1/2N) to a threshold set to 15% higher than the target output voltage (default setting). The fault threshold can be set to a desired level by the PMBus command VOUT_OV_FAULT_LIMIT. If the VSEN1/2P, VSEN1/2N voltage exceeds this threshold, the module initiates an immediate shutdown without retry. Internal to the module, two 100 resistors are populated from VOUT to VSEN1/2P and SGND to VSEN1/2N to protect the module from overvoltage conditions in case of open at the voltage sensing pins and differential remote sense traces due to assembly error. As long as differential remote sense traces have low resistance, VOUT regulation accuracy is not compromised. 4.11 Output Prebias Protection An output prebias condition exists when an externally applied voltage is present on a power supply's output before the power supply's control IC is enabled. Certain applications require that the converter not be allowed to sink current during start-up if a prebias condition exists at the output. The RAA210925 provides prebias protection by sampling the output voltage before initiating an output ramp. If a prebias voltage lower than the target voltage exists after the preconfigured delay period has expired, the target voltage is set to match the existing prebias voltage and both drivers are enabled. The output voltage is then ramped to the final regulation value at the preconfigured ramp rate. The actual time the output takes to ramp from the prebias voltage to the target voltage varies, depending on the prebias voltage. However, the total time elapsed from when the delay period expires to when the output reaches its target value matches the preconfigured ramp time (see Figure 31 on page 32). FN9352 Rev.1.00 May 31, 2019 Page 31 of 64 RAA210925 4. Functional Description VOUT Desired Output Voltage VOUT PrebiasVoltage Desired Output Voltage Prebias voltage Time TON-DELAY TON-RISE TON-DELAY Time TON-RISE VPREBIAS < VTARGET VPREBIAS < VTARGET VOUT VOUT Prebias Voltage Desired Output Voltage Prebias Voltage Desired Output Voltage Time TON-DELAY TON-RISE VPREBIAS > VTARGET Time TON-DELAY TON-RISE VPREBIAS > VTARGET Figure 31. Output Responses to Prebias Voltages If a prebias voltage is higher than the target voltage after the preconfigured delay period has expired, the target voltage is set to match the existing prebias voltage. Thus, both drivers are enabled with a PWM duty cycle that would ideally create the prebias voltage. When the preconfigured soft-start ramp period has expired, the PG pin is asserted (assuming the prebias voltage is not higher than the overvoltage limit). The PWM then adjusts its duty cycle to match the original target voltage and the output ramps down to the preconfigured output voltage. If a prebias voltage is higher than the overvoltage limit, the device does not initiate a turn-on sequence and declares an overvoltage fault condition. 4.12 Thermal Overload Protection The RAA210925 includes a thermal sensor that continuously measures the internal temperature of the module and shuts down the controller when the temperature exceeds the preset limit. The factory default temperature limit is set to +115C, and can be changed using the PMBus command OT_FAULT_LIMIT. Note that the temperature reading from the PMBus command is the temperature of the internal controller, which is lower than the junction temperature of the module. The default response from an over-temperature fault is an immediate shutdown without retry. FN9352 Rev.1.00 May 31, 2019 Page 32 of 64 RAA210925 4.13 4. Functional Description Phase Spreading When multiple point-of-load converters share a common DC input supply, adjust the clock phase offset of each device so that not all devices start to switch simultaneously. Setting each converter to start its switching cycle at a different point in time can dramatically reduce input capacitance requirements and efficiency losses. Because the peak current drawn from the input supply is effectively spread out over a period of time, the peak current drawn at any given moment is reduced, and the power losses proportional to the IRMS2 are reduced dramatically. To enable phase spreading, all converters must be synchronized to the same switching clock. The phase offset of each device can also be set to any value between 0 and 360 in 22.5 increments by setting the device address appropriately as shown in Table 11. This functionality can also be accessed using the PMBus command INTERLEAVE. The internal two phases of the module always maintain a phase difference of 180. The phase offset between devices is determined from the lower four bits of the SMBus address of each interleaved device. Table 11. INTERLEAVE SA UVLO R (k) SA in Binary Low 4-Bits INTERLEAVE-Ch1 Phase Shift () Rail ID 19h 10.8 10 00011001 1001 9 202.5 25 1Ah 10.8 11 00011010 1010 10 225 26 1Bh 10.8 12.1 00011011 1011 11 247.5 27 1Ch 10.8 13.3 00011100 1100 12 270 28 1Dh 10.8 14.7 00011101 1101 13 292.5 29 1Eh 10.8 16.2 00011110 1110 14 315 30 1Fh 10.8 17.8 00011111 1111 15 337.5 31 20h 4.2 19.6 00100000 0000 0 0 0 21h 4.2 21.5 00100001 0001 1 22.5 1 22h 4.2 23.7 00100010 0010 2 45 2 23h 4.2 26.1 00100011 0011 3 67.5 3 24h 4.2 28.7 00100100 0100 4 90 4 25h 4.2 31.6 00100101 0101 5 112.5 5 26h 4.2 34.8, low 00100110 0110 6 135 6 27h 4.2 38.3 00100111 0111 7 157.5 7 28h 4.5 42.2, open 00101000 1000 8 180 8 29h 4.5 46.4 00101001 1001 9 202.5 9 2Ah 4.5 51.1 00101010 1010 10 225 10 2Bh 4.5 56.2 00101011 1011 11 247.5 11 2Ch 4.5 61.9 00101100 1100 12 270 12 2Dh 4.5 68.1 00101101 1101 13 292.5 13 2Eh 4.5 75 00101110 1110 14 315 14 2Fh 4.5 82.5 00101111 1111 15 337.5 15 30h 10.8 90.9 00110000 0000 0 0 16 31h 10.8 100 00110001 0001 1 22.5 17 32h 10.8 110 00110010 0010 2 45 18 33h 10.8 121 00110011 0011 3 67.5 19 34h 10.8 133 00110100 0100 4 90 20 35h 10.8 147 00110101 0101 5 112.5 21 36h 10.8 162 00110110 0110 6 135 22 37h 10.8 178 00110111 0111 7 157.5 23 FN9352 Rev.1.00 May 31, 2019 Page 33 of 64 RAA210925 4.14 4. Functional Description Monitoring Using SMBus The RAA210925 can monitor a wide variety of different system parameters using the PMBus commands: * READ_VIN * READ_VOUT * READ_IOUT * READ_INTERNAL_TEMP * READ_DUTY_CYCLE * READ_FREQUENCY 4.15 Snapshot Parameter Capture The RAA210925 offers a special feature to capture parametric data and fault status following a fault. A detailed description is provided in the "PMBus Commands Description" on page 41 under PMBus the commands SNAPSHOT and SNAPSHOT_CONTROL. FN9352 Rev.1.00 May 31, 2019 Page 34 of 64 RAA210925 5. 5. Layout Guide Layout Guide To achieve stable operation, low losses, and good thermal performance, some layout considerations are necessary (Figure 32). Refer to the RTKA2109252H00000BU layout design. * Establish separate SGND plane and PGND planes, then connect SGND to PGND plane on a middle layer and underneath PAD6 with a single point connection. For SGND and PGND pin connections, such as small pins H16, J16, M5 and M17..., use multiple vias for each pin to connect to inner SGND or PGND layers. * Place enough ceramic capacitors between VIN and PGND, VOUT and PGND and bypass capacitors between VDD, VDRV and the ground plane, as close to the module as possible to minimize high frequency noise. It is very critical to place the output ceramic capacitors close to the VOUT pads and in the direction of the load current path in order to create a low impedance path for the high frequency inductor ripple current. * Use large copper areas for power paths (VIN, PGND, VOUT) to minimize conduction loss and thermal stress. Also, use multiple vias to connect the power planes in different layers. It is recommended to enlarge PAD11 and PAD9 to place more vias on them. The ceramic capacitors CIN can be placed on the bottom layer under these two pads. * Connect remote sensing traces to the regulation point to achieve a tight output voltage regulation and place the two traces in parallel. Route a trace from VSEN1/2N and VSEN1/2P to the point of load where the tight output voltage is desired. Avoid routing any sensitive signal traces, such as the VSENN, VSENP sensing lines near the SW pins. * PAD14 and 16 (SW1 and SW2) are noisy pads, but they are beneficial for thermal dissipation. If the noise issue is critical for the applications, it is recommended to use only the top layer for the SW pads. For better thermal performance, use multiple vias on these pads to connect into the SW inner and bottom layers. However, use caution when placing a limited area of SW planes in any layer. The SW planes should avoid the sensing signals and should be surrounded by the PGND layer to avoid noise coupling. * For pins SWD1 (L3) and SWD2 (P10), it is recommended to connect to the related SW1 and SW2 pads with short loop traces. The trace width should be more than 20 mils. VOUT1 COUT1 PGND COUT2 SGND PGND VOUT2 PGND VSEN1N VSEN1P Kelvin Connections for Both Ch1 and Ch2 VIN VIN CIN CIN PGND Figure 32. Recommended Layout FN9352 Rev.1.00 May 31, 2019 Page 35 of 64 RAA210925 5.1 5. Layout Guide Thermal Considerations Experimental power loss curves along with JA from thermal modeling analysis can be used to evaluate the thermal consideration for the module. The derating curves are derived from the maximum power allowed while maintaining the temperature below the maximum junction temperature of +125C. The derating curves are derived based on tests of the RTKA2109252H00000BU evaluation board, which is an 8-layer board 4.5x4inch in size with 2oz Cu on the top and bottom layers, 1oz Cu on the inner layers, and multiple via interconnects. In the actual application, other heat sources and design margins should be considered. 5.2 Package Description The structure of the RAA210925 belongs to the High Density Array (HDA) no-lead package. This kind of package has advantages, such as good thermal and electrical conductivity, low weight, and small size. The HDA package is applicable for surface mounting technology and is being more readily used in the industry. The RAA210925 contains several types of devices, including resistors, capacitors, inductors, and control ICs. The RAA210925 is a copper leadframe based package with exposed copper thermal pads, which have good electrical and thermal conductivity. The copper leadframe and multicomponent assembly is overmolded with a polymer mold compound to protect these devices. The package outline and typical PCB layout pattern design and typical stencil pattern design are shown on pages 57 through page 63. The module has a small size of 18mmx 23mmx7.5mm. 5.3 PCB Layout Pattern Design The bottom of RAA210925 is a leadframe footprint, which is attached to the PCB by the surface mounting process. The PCB layout pattern is shown on pages 61 through 63. The PCB layout pattern is an array of solder mask defined PCB lands which align with the perimeters of the HDA exposed pads and I/O termination dimensions. The thermal lands on the PCB layout also feature an array of solder mask defined lands and should match 1:1 with the package exposed die pads. 5.4 Thermal Vias A grid of 1.0mm to 1.2mm pitch thermal vias, which drops down and connects to buried copper plane(s), should be placed under the thermal land. The vias should be about 0.3mm to 0.33mm in diameter with the barrel plated to about 1.0 oz. of copper. Although adding more vias (by decreasing via pitch) improves the thermal performance, diminishing returns are seen as the number of vias is increased. Simply use as many vias as practical for the thermal land size and your board design rules allow. All vias should be capped and filled to avoid scavenging solder from the I/O solder joints and creating voids. 5.5 Stencil Pattern Design Reflowed solder joints on the perimeter I/O lands should have about a 50m to 75m (2 mil to 3 mil) standoff height. The solder paste stencil design is the first step in developing optimized, reliable solder joins. Stencil aperture size to solder mask defined PCB land size ratio should typically be 1:1. The aperture width may be reduced slightly to help prevent solder bridging between adjacent I/O lands. To reduce solder paste volume on the larger thermal lands, it is recommended that an array of smaller apertures be used instead of one large aperture. It is recommended that the stencil printing area cover 50% to 80% of the PCB layout pattern. A typical solder stencil pattern is shown on pages 59 through 61. The gap width between pads is 0.6mm. The user should consider the symmetry of the whole stencil pattern when designing its pads. A laser cut, stainless steel stencil with electropolished trapezoidal walls is recommended. Electropolishing "smooths" the aperture walls resulting in reduced surface friction and better paste release, which reduces voids. Using a Trapezoidal Section Aperture (TSA) also promotes paste release and forms a "brick like" paste deposit that assists in firm component placement. A 0.1mm to 0.15mm stencil thickness is recommended for this large pitch (1.3mm) HDA. FN9352 Rev.1.00 May 31, 2019 Page 36 of 64 RAA210925 5.6 5. Layout Guide Reflow Parameters Due to the low mount height of the HDA, "No-Clean" Type 3 solder paste per ANSI/J-STD-005 is recommended. A nitrogen purge is also recommended during reflow. A system board reflow profile depends on the thermal mass of the entire populated board, so it is not practical to define a specific soldering profile just for the HDA. The profile given in Figure 33 is provided as a guideline, which can be customized for varying manufacturing practices and applications. 300 Peak Temperature ~+245C; Typically 60s-150s Above +217C Keep Less than 30s within 5C of Peak Temp. Temperature (C) 250 200 Slow Ramp (3C/s Max) and Soak From +150C to +200C for 60s~180s 150 100 Ramp Rate 1.5C from +70C to +90C 50 0 0 100 150 200 250 300 350 Duration (s) Figure 33. Typical Reflow Profile FN9352 Rev.1.00 May 31, 2019 Page 37 of 64 RAA210925 6. 6. PMBus Command Summary PMBus Command Summary Command Code Command Name Description Type Data Format Default Value 00h Default Setting Page 00h PAGE Selects Controller 0, 1, or both. R/W Byte BIT 01h OPERATION Sets Enable and Disable modes. R/W Byte BIT 02h ON_OFF_CONFIG Configures the EN pin and PMBus commands to turn the unit ON/OFF. R/W Byte BIT 03h CLEAR_FAULTS Clears fault indications. SEND Byte 21h VOUT_COMMAND Sets the nominal value of the output voltage. R/W Word L16u Pin-strap 42 24h VOUT_MAX Sets the maximum possible value of VOUT. 110% of pin-strap VOUT. R/W Word L16u 1.1 x VOUT Pin-strap 42 33h FREQUENCY_SWITCH Sets the switching frequency. R/W Word L11 Pin-strap 42 37h INTERLEAVE Configures a phase offset between devices sharing a SYNC clock. R/W Word BIT 40h VOUT_OV_FAULT_LIMIT Sets the VOUT overvoltage fault threshold. R/W Word L16u 1.15 x VOUT Pin-strap 43 44h VOUT_UV_FAULT_LIMIT Sets the VOUT undervoltage fault threshold. R/W Word L16u 0.85 x VOUT Pin-strap 43 46h IOUT_OC_FAULT_LIMIT Sets the IOUT peak overcurrent fault threshold. R/W Word L11 E320h 50A 44 4Bh IOUT_UC_FAULT_LIMIT Sets the IOUT valley undercurrent fault threshold. R/W Word L11 E4E0h -50A 44 4Fh OT_FAULT_LIMIT Sets the over-temperature fault threshold. R/W Word L11 EB98h +115C 44 53h UT_FAULT_LIMIT Sets the under-temperature fault threshold. R/W Word L11 E530h -45C 45 55h VIN_OV_FAULT_LIMIT Sets the VIN overvoltage fault threshold. R/W Word L11 D3A0 14.5V 45 59h VIN_UV_FAULT_LIMIT Sets the VIN undervoltage fault threshold. R/W Word L11 Pin-strap 45 5Eh POWER_GOOD_ON Sets the voltage threshold for power-good indication. R/W Word L16u 0.9 x VOUT Pin-strap 45 60h TON_DELAY Sets the delay time from ENABLE to start of VOUT rise. R/W Word L11 Pin-strap 46 FN9352 Rev.1.00 May 31, 2019 Channel 1 41 41 16h Hardware Pin Enable, soft-off 41 42 1000h(Ch1)/ 180 phase shift 0000h(Ch2) between Ch1/Ch2 43 Page 38 of 64 RAA210925 6. PMBus Command Summary Command Code Command Name Description Type Data Format Default Value Default Setting Page 61h TON_RISE Sets the rise time of VOUT after ENABLE and TON_DELAY. R/W Word L11 Pin-strap 46 64h TOFF_DELAY Sets the delay time from DISABLE to start of VOUT fall. R/W Word L11 Pin-strap 46 65h TOFF_FALL Sets the fall time for VOUT after DISABLE and TOFF_DELAY. R/W Word L11 Pin-strap 46 78h STATUS_BYTE Returns an abbreviated status for fast reads. Read Byte BIT 00h No Faults 47 79h STATUS_WORD Returns information with a summary of the units's fault condition. Read Word BIT 0000h No Faults 48 7Ah STATUS_VOUT Returns the VOUT specific status. Read Byte BIT 00h No Faults 48 7Bh STATUS_IOUT Returns the IOUT specific status. Read Byte BIT 00h No Faults 49 7Ch STATUS_INPUT Returns status specific to the input. Read Byte BIT 00h No Faults 49 7Dh STATUS_TEMP Returns the temperature specific status. Read Byte BIT 00h No Faults 49 7Eh STATUS_CML Returns the communication, logic and memory specific status. Read Byte BIT 00h No Faults 50 80h STATUS_MFR_SPECIFIC Returns the external sync clock specific status. Read Byte BIT 00h No Faults 50 88h READ_VIN Returns the input voltage reading. Read Word L11 50 8Bh READ_VOUT Returns the output voltage reading. Read Word L16u 51 8Ch READ_IOUT Returns the output current reading. Read Word L11 51 8Dh READ_INTERNAL_TEMP Returns the temperature reading internal to the device. Read Word L11 51 94h READ_DUTY_CYCLE Returns the duty cycle reading during the ENABLE state. Read Word L11 51 95h READ_FREQUENCY Returns the measured operating switch frequency. Read Word L11 51 DFh ASCR_CONFIG Configures ASCR control loop. R/W Block CUS Pin-strap 52 E4h DEVICE_ID Returns the 16-byte (character) device identifier string. Read Block ASC Reads Device Version 52 E5h MFR_IOUT_OC_FAULT_ RESPONSE Configures the IOUT overcurrent fault response. R/W Byte BIT B9h Disable and Retry with 70ms delay 52 E6h MFR_IOUT_UC_FAULT_ RESPONSE Configures the IOUT undercurrent fault response. R/W Byte BIT B9h Disable and Retry with 70ms delay 53 FN9352 Rev.1.00 May 31, 2019 Page 39 of 64 RAA210925 6. PMBus Command Summary Command Code Command Name Description Type Data Format Default Value Default Setting Page E7h IOUT_AVG_OC_FAULT_LIMIT Sets the IOUT average overcurrent fault threshold. R/W L11 E8h IOUT_AVG_UC_FAULT_LIMIT Sets the IOUT average undercurrent fault threshold. R/W L11 EAh SNAPSHOT Returns 32-byte read-back of parametric and status values. Read Block BIT 55 F3h SNAPSHOT_CONTROL Snapshot feature control command. R/W Byte BIT 55 6.1 DC40h Set by SYNC/OCP pin-strap 53 -30A 54 PMBus Data Formats * Linear-11 (L11) - The L11 data format uses 5-bit two's complement exponent (N) and 11-bit two's complement mantissa (Y) to represent the real world decimal value (X). The relation between the real world decimal value (X), N, and Y is: X = Y2N Data Byte High Data Byte Low 7 6 5 4 3 2 1 0 7 6 5 4 3 2 1 0 Exponent (N) Mantissa (Y) * Linear-16 Unsigned (L16u) - The L16u data format uses a fixed exponent (hard-coded to N = -13h) and a 16-bit unsigned integer mantissa (Y) to represent real world decimal value (X). The relation between the real world decimal value (X), N and Y is: X = Y2-13 * Linear-16 Signed (L16s) - The L16s data format uses a fixed exponent (hard-coded to N = -13h) and a 16-bit two's complement mantissa (Y) to represent real world decimal value (X). The relation between the real world decimal value (X), N and Y is: X = Y2-13 * Bit Field (BIT) - An explanation of the Bit Field for each command is provided in "PMBus Commands Description" on page 41. * Custom (CUS) - An explanation of the Custom data format for each command is provided in "PMBus Commands Description" on page 41. A combination of Bit Field and integer are common type of Custom data format. * ASCII (ASC) - A variable length string of text characters uses ASCII data format. 6.2 PMBus Use Guidelines The PMBus is a powerful tool that allows the user to optimize circuit performance by configuring devices for their application. When configuring a device in a circuit, the device should be disabled whenever most settings are changed with PMBus commands. Some exceptions to this recommendation are OPERATION, ON_OFF_CONFIG, CLEAR_FAULTS, VOUT_COMMAND, and ASCR_CONFIG. While the device is enabled any command can be read. Many commands do not take effect until after the device has been re-enabled, hence the recommendation that commands that change device settings are written while the device is disabled. In addition, there should be a 2ms delay between repeated READ commands sent to the same device. When sending any other command, a 5ms delay is recommended between repeated commands sent to the same device. FN9352 Rev.1.00 May 31, 2019 Page 40 of 64 RAA210925 7. 7. PMBus Commands Description PMBus Commands Description PAGE(00h) Definition: Select Channel 1, Channel 2 or both channels to receive commands. All commands following this command are received and acted on by the selected channel or channels. Data Length in Bytes: 1 Data Format: BIT Type: R/W Default Value: 00h (Page 0) Units: N/A Bits 7:4 Bits 3:0 Page 0000 0000 0 0000 0001 1 1111 1111 Both OPERATION (01h) Definition: Sets Enable and Disable settings. Data Length in Bytes: 1 Data Format: BIT Type: R/W Default Value: Units: N/A Settings Actions 00h Immediate off 40h Soft off 80h On ON_OFF_CONFIG (02h) Definition: Configures the interpretation and coordination of the OPERATION command and the ENABLE pin (EN). Data Length in Bytes: 1 Data Format: BIT Type: R/W Default Value: 16h (Device starts from ENABLE pin with soft-off) Units: N/A Settings FN9352 Rev.1.00 May 31, 2019 Actions 16h Device starts from the ENABLE pin with soft off. 17h Device starts from the ENABLE pin with immediate off. 1Ah Device starts from the OPERATION command with soft off. 1Bh Device starts from the OPERATION command with immediate off. Page 41 of 64 RAA210925 7. PMBus Commands Description CLEAR_FAULTS (03h) Definition: Clears all fault bits in all registers. If a fault condition still exists, the bit reasserts immediately. This command does not restart a device if it has shut down, it only clears the faults. Data Length in Bytes: 0 Byte Data Format: N/A Type: Send byte Default Value: N/A Units: N/A Reference: N/A VOUT_COMMAND (21h) Definition: Sets or reports the target output voltage. This command cannot set a value higher than VOUT_MAX. Data Length in Bytes: 2 Data Format: L16u Type: R/W Default Value: Pin-strap setting Units: Volts Range: 0V to VOUT_MAX VOUT_MAX (24h) Definition: Sets an upper limit on the output voltage the unit can command regardless of any other commands or combinations. The intent of this command is to provide a safeguard against a user accidentally setting the output voltage to a possibly destructive level rather than to be the primary output overprotection. Default value can be changed using PMBus. Data Length in Bytes: 2 Data Format: L16u Type: R/W Default Value: 1.10 x VOUT pin-strap setting Units: Volts Range: 0V to 5.5V FREQUENCY_SWITCH (33h) Definition: Sets the switching frequency of the device. Initial default value is defined by a pin-strap and this value can be overridden by writing this command through the PMBus. If using an external SYNC, set this value as close as possible to the external clock value. The output must be disabled when writing this command. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: Pin-strap setting Units: kHz Range: 296kHz to 1067kHz FN9352 Rev.1.00 May 31, 2019 Page 42 of 64 RAA210925 7. PMBus Commands Description INTERLEAVE (37h) Definition: Configures the phase offset of a device that is sharing a common SYNC clock with other devices. The phase offset of each device can be set to any value between 0 and 360 in 22.5 increments. The internal two phases of the module always maintain a phase difference of 180. Data Length in Bytes: 2 Data Format: BIT Type: R/W Default Value: 1000h (Page0), 0000h (Page1) Units: N/A Bits Purpose Value 0 Description 15:8 Reserved Reserved 7:4 Group Number 0 to 15 Sets the group number. A value of 0 is interpreted as 16. 3:0 Position in Group 0 to 15 Sets position of the device's rail within the group. VOUT_OV_FAULT_LIMIT (40h) Definition: Sets the VOUT overvoltage fault threshold. Data Length in Bytes: 2 Data Format: L16u Type: R/W Default Value: 1.15 x VOUT pin-strap setting Units: V Range: 0V to VOUT_MAX VOUT_UV_FAULT_LIMIT (44h) Definition: Sets the VOUT undervoltage fault threshold. This fault is masked during ramp or when disabled. Data Length in Bytes: 2 Data Format: L16u Type: R/W Default Value: 0.85 x VOUT pin-strap setting Units: V Range: 0V to VOUT_MAX FN9352 Rev.1.00 May 31, 2019 Page 43 of 64 RAA210925 7. PMBus Commands Description IOUT_OC_FAULT_LIMIT (46h) Definition: Sets the IOUT peak overcurrent fault threshold. This limit is applied to current measurement samples taken after the Current Sense Blanking Time has expired. A fault occurs after this limit is exceeded. The recommended peak OCP limit is determined by Equation 1. (EQ. 1) IOUT_OC_FAULT_LIMIT = IOUT_AVG_OC_FAULT_LIMIT + 0.5 IRIPPLE P - P 130% A hard bound of 50A is applied to the command value. This feature shares the OC fault bit operation (in STATUS_IOUT) and OC fault response with the IOUT_AVG_OC_FAULT_LIMIT. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: E320h (50A) Units: A Range: -100A to 100A IOUT_UC_FAULT_LIMIT (4Bh) Definition: Sets the IOUT valley undercurrent fault threshold. This limit is applied to current measurement samples taken after the Current Sense Blanking Time has expired. A fault occurs after this limit is exceeded. The recommended valley UCP limit is determined by Equation 2: (EQ. 2) IOUT_UC_FAULT_LIMIT = IOUT_AVG_UC_FAULT_LIMIT - 0.5 IRIPPLE P - P 130% A hard bound of -50A is applied to the command value. This feature shares the UC fault bit operation (in STATUS_IOUT) and UC fault response with IOUT_AVG_UC_FAULT_LIMIT. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: E4E0 (-50A) Units: A Range: -100A to 100A OT_FAULT_LIMIT (4Fh) Definition: Sets the temperature at which the device should indicate an over-temperature fault. Note that the temperature must drop below the fault threshold to clear this fault. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: EB98 (+115C) Units: C Range: 0C to +175C FN9352 Rev.1.00 May 31, 2019 Page 44 of 64 RAA210925 7. PMBus Commands Description UT_FAULT_LIMIT (53h) Definition: Sets the temperature, in degrees Celsius, of the unit where it should indicate an under-temperature fault. Note that the temperature must rise above the fault threshold to clear this fault. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: E530h (-45C) Units: C Range: -55C to +25C VIN_OV_FAULT_LIMIT (55h) Definition: Sets the VIN overvoltage fault threshold. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: D3A0 (14.5V) Units: V Range: 0V to 16V VIN_UV_FAULT_LIMIT (59h) Definition: Sets the VIN undervoltage fault threshold. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: Pin-strap setting Units: V Range: 0V to 12V POWER_GOOD_ON (5Eh) Definition: Sets the voltage threshold for power-good indication. Power-good asserts after the output voltage exceeds POWER_GOOD_ON and deasserts when the output voltage is less than VOUT_UV_FAULT_LIMIT. It is recommended to set POWER_GOOD_ON higher than VOUT_UV_FAULT_LIMIT. Data Length in Bytes: 2 Data Format: L16u Type: R/W Default Value: 0.9 x VOUT pin-strap setting Units: V FN9352 Rev.1.00 May 31, 2019 Page 45 of 64 RAA210925 7. PMBus Commands Description TON_DELAY (60h) Definition: Sets the delay time from when the device is enabled to the start of VOUT rise. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: Pin-strap setting Units: ms Range: 2ms to 300ms TON_RISE (61h) Definition: Sets the rise time of VOUT after ENABLE and TON_DELAY. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: Pin-strap setting Units: ms Range: 1ms to 120ms TOFF_DELAY (64h) Definition: Sets the delay time from DISABLE to start of VOUT fall. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: Pin-strap setting Units: ms Range: 2ms to 300ms TOFF_FALL (65h) Definition: Sets the soft-off fall time for VOUT after DISABLE and TOFF_DELAY. Data Length in Bytes: 2 Data Format: L11 Type: R/W Default Value: Pin-strap setting Units: ms Range: 0ms to 120ms FN9352 Rev.1.00 May 31, 2019 Page 46 of 64 RAA210925 7. PMBus Commands Description STATUS_BYTE (78h) Definition: Returns one byte of information with a summary of the most critical faults. Data Length in Bytes: 1 Data Format: BIT Type: Read Only Default Value: 00h Units: N/A Bit Number Status Bit Name Meaning 7 BUSY A fault was declared because the device was busy and unable to respond. 6 OFF This bit is asserted if the unit is not providing power to the output, regardless of the reason, including simply not being enabled. 5 VOUT_OV_FAULT An output overvoltage fault has occurred. 4 IOUT_OC_FAULT An output overcurrent fault has occurred. 3 VIN_UV_FAULT An input undervoltage fault has occurred. 2 TEMPERATURE A temperature fault has occurred. 1 CML A communications, memory, or logic fault has occurred. 0 NONE OF THE ABOVE A fault not listed in Bits 7:1 has occurred. FN9352 Rev.1.00 May 31, 2019 Page 47 of 64 RAA210925 7. PMBus Commands Description STATUS_WORD (79h) Definition: Returns two bytes of information with a summary of the unit's fault condition. Based on the information in these bytes, the host can get more information by reading the appropriate status registers. The low byte of the STATUS_WORD is the same register as the STATUS_BYTE (78h) command. Data Length in Bytes: 2 Data Format: BIT Type: Read Only Default Value: 0000h Units: N/A Bit Number Status Bit Name Meaning 15 VOUT An output voltage fault has occurred. 14 IOUT/POUT An output current or output power fault has occurred. 13 INPUT An input voltage, input current, or input power fault has occurred. 12 MFG_SPECIFIC A manufacturer specific fault has occurred. 11 POWER_GOOD# The POWER_GOOD signal, if present, is negated. 10 Reserved Reserved 9 OTHER A bit in STATUS_OTHER is set. 8 UNKNOWN A fault type not given in Bits 15:1 of the STATUS_WORD has been detected. 7 BUSY A fault was declared because the device was busy and unable to respond. 6 OFF This bit is asserted if the unit is not providing power to the output, regardless of the reason, including simply not being enabled. 5 VOUT_OV_FAULT An output overvoltage fault has occurred. 4 IOUT_OC_FAULT An output overcurrent fault has occurred. 3 VIN_UV_FAULT An input undervoltage fault has occurred. 2 TEMPERATURE A temperature fault has occurred. 1 CML A communications, memory, or logic fault has occurred. 0 NONE OF THE ABOVE A fault not listed in Bits 7:1 has occurred. STATUS_VOUT (7Ah) Definition: Returns one data byte with the status of the output voltage. Data Length in Bytes: 1 Data Format: BIT Type: Read Only Default Value: 00h Units: N/A Bit Number 7 6:5 4 3:0 Status Bit Name Meaning VOUT_OV_FAULT Indicates an output overvoltage fault. Reserved Reserved VOUT_UV_FAULT Indicates an output undervoltage fault. N/A These bits are not used. FN9352 Rev.1.00 May 31, 2019 Page 48 of 64 RAA210925 7. PMBus Commands Description STATUS_IOUT (7Bh) Definition: Returns one data byte with the status of the output current. Data Length in Bytes: 1 Data Format: BIT Type: Read Only Default Value: 00h Units: N/A Bit Number 7 6:5 4 3:0 Status Bit Name Meaning IOUT_OC_FAULT An output overcurrent fault has occurred. Reserved Reserved IOUT_UC_FAULT An output undercurrent fault has occurred. N/A These bits are not used. STATUS_INPUT (7Ch) Definition: Returns the input voltage and input current status information. Data Length in Bytes: 1 Data Format: BIT Type: Read Only Default Value: 00h Units: N/A Bit Number 7 6:5 4 3:0 Status Bit Name Meaning VIN_OV_FAULT An input overvoltage fault has occurred. Reserved Reserved VIN_UV_FAULT An input undervoltage fault has occurred. N/A These bits are not used. STATUS_TEMP (7Dh) Definition: Returns one byte of information with a summary of any temperature related faults. Data Length in Bytes: 1 Data Format: BIT Type: Read Only Default Value: 00h Units: N/A Bit Number 7 6:5 4 3:0 Status Bit Name Meaning OT_FAULT An over-temperature fault has occurred. Reserved Reserved UT_FAULT An under-temperature fault has occurred. N/A These bits are not used. FN9352 Rev.1.00 May 31, 2019 Page 49 of 64 RAA210925 7. PMBus Commands Description STATUS_CML (7Eh) Definition: Returns one byte of information with a summary of any communications, logic, and/or memory errors. Data Length in Bytes: 1 Data Format: BIT Type: Read Only Default Value: 00h Units: N/A Bit Number Meaning 7 Invalid or unsupported PMBus command was received. 6 The PMBus command was sent with invalid or unsupported data. 5 Packet error was detected in the PMBus command. 4 Memory/logic fault has occurred. 3:2 Reserved 1 A PMBus command tried to write to a read-only or protected command, or a communication fault other than the ones listed in this table has occurred. 0 Not used STATUS_MFR_SPECIFIC (80h) Definition: Returns one byte of information providing the status of the clock synchronization faults. Data Length in Bytes: 1 Data Format: BIT Type: Read only Default value: 00h Units: N/A Bit Number 7:4 3 2:0 Field Name Meaning Reserved Reserved External Switching Period Fault Loss of external clock synchronization has occurred. Reserved Reserved READ_VIN (88h) Definition: Returns the input voltage reading. Data Length in Bytes: 2 Data Format: L11 Type: Read Only Units: V FN9352 Rev.1.00 May 31, 2019 Page 50 of 64 RAA210925 7. PMBus Commands Description READ_VOUT (8Bh) Definition: Returns the output voltage reading. Data Length in Bytes: 2 Data Format: L16u Type: Read Only Units: V READ_IOUT (8Ch) Definition: Returns the output current reading. Data Length in Bytes: 2 Data Format: L11 Type: Read Only Default Value: N/A Units: A READ_INTERNAL_TEMP (8Dh) Definition: Returns the controller junction temperature reading from the internal temperature sensor. Data Length in Bytes: 2 Data Format: L11 Type: Read Only Units: C READ_DUTY_CYCLE (94h) Definition: Reports the actual duty cycle of the converter during the enable state. Data Length in Bytes: 2 Data Format: L11 Type: Read only Units: % READ_FREQUENCY (95h) Definition: Reports the actual switching frequency of the converter during the enable state. Data Length in Bytes: 2 Data Format: L11 Type: Read only Units: kHz FN9352 Rev.1.00 May 31, 2019 Page 51 of 64 RAA210925 7. PMBus Commands Description ASCR_CONFIG (DFh) Definition: Allows user configuration of ASCR settings. ASCR gain is analogous to bandwidth, ASCR residual is analogous to damping. To improve load transient response performance, increase ASCR gain. To lower transient response overshoot, increase ASCR residual. Increasing ASCR gain can result in increased PWM jitter and should be evaluated in the application circuit. Excessive ASCR gain can lead to excessive output voltage ripple. Increasing ASCR residual to improve transient response damping can result in slower recovery times, but does not affect the peak output voltage deviation. Typical ASCR gain settings range from 50 to 1000, and ASCR residual settings range from 10 to 100. Data Length in Bytes: 4 Data Format: CUS Type: R/W Default Value: Pin-strap setting Bit 31:25 24 Purpose Data Format Unused Value Description 0000000h Unused Reserved Reserved 23:16 ASCR Residual Setting Integer ASCR residual 15:0 ASCR Gain Setting Integer ASCR gain DEVICE_ID (E4h) Definition: Returns the 16-byte (character) device identifier string. Data Length in Bytes: 16 Data Format: ASC Type: Block Read Default Value: Part number/Die revision/Firmware revision MFR_IOUT_OC_FAULT_RESPONSE (E5h) Definition: Configures the IOUT overcurrent fault response as defined by the following table. The command format is the same as the PMBus standard fault responses except that it sets the overcurrent status bit in STATUS_IOUT. Data Length in Bytes: 1 Data Format: BIT Type: R/W Default Value: B9h (Disable and continuous retry with 70ms delay) Units: N/A Field Name Actions 80h Disable with no retry. B9h Disable and continuous retry with 70ms delay FN9352 Rev.1.00 May 31, 2019 Page 52 of 64 RAA210925 7. PMBus Commands Description MFR_IOUT_UC_FAULT_RESPONSE (E6h) Definition: Configures the IOUT undercurrent fault response as defined by the following table. The command format is the same as the PMBus standard fault responses except that it sets the undercurrent status bit in STATUS_IOUT. Data Length in Bytes: 1 Data Format: BIT Type: R/W Default Value: B9h (Disable and continuous retry with 70ms delay) Units: N/A Field Name Actions 80h Disable with no retry. B9h Disable and continuous retry with 70ms delay IOUT_AVG_OC_FAULT_LIMIT (E7h) Definition: Sets the IOUT average overcurrent fault threshold. For down-slope sensing, this corresponds to the average of all the current samples taken during the (1-D) time interval, excluding the current sense blanking time (which occurs at the beginning of the 1-D interval). For up-slope sensing, this corresponds to the average of all the current samples taken during the D time interval, excluding the current sense blanking time (which occurs at the beginning of the D interval). This feature shares the OC fault bit operation (in STATUS_IOUT) and OC fault response with IOUT_OC_FAULT_LIMIT. Paged or Global: Paged Data Length in Bytes: 2 Data Format: Linear-11 Type: R/W Protectable: Yes Default Value: SYNC/OCP pin-strap setting Units: A Range: -100A to 100A FN9352 Rev.1.00 May 31, 2019 Page 53 of 64 RAA210925 7. PMBus Commands Description IOUT_AVG_UC_FAULT_LIMIT (E8h) Definition: Sets the IOUT average undercurrent fault threshold. For down-slope sensing, this corresponds to the average of all the current samples taken during the (1-D) time interval, excluding the current sense blanking time (which occurs at the beginning of the 1-D interval). For up-slope sensing, this corresponds to the average of all the current samples taken during the D time interval, excluding the current sense blanking time (which occurs at the beginning of the D interval). This feature shares the UC fault bit operation (in STATUS_IOUT) and UC fault response with IOUT_ UC_FAULT_LIMIT. Paged or Global: Paged Data Length in Bytes: 2 Data Format: Linear-11 Type: R/W Protectable: Yes Default Value: DC40h (-30A) Units: A Range: -100A to 100A FN9352 Rev.1.00 May 31, 2019 Page 54 of 64 RAA210925 7. PMBus Commands Description SNAPSHOT (EAh) Definition: A 32-byte read-back of parametric and status values. It allows monitoring and status data to be stored to flash following a fault condition. In case of a fault, last updated values are stored to the flash memory. When the SNAPSHOT STATUS bit is set stored, the device no longer automatically captures parametric and status values following fault until stored data are erased. Use the SNAPSHOT_CONTROL command to erase store data and clear the status bit before next ramp up. Data erased is not allowed when module is enabled. Data Length in Bytes: 32 Data Format: Bit field Type: Block Read Byte Number 31:23 Value PMBus Command Format Reserved Reserved 00h 22 Flash Memory Status Byte FF - Not Stored 00 - Stored NVM Status Byte BIT 21 Manufacturer Specific Status Byte STATUS_MFR_SPECIFIC (80h) Byte 20 CML Status Byte STATUS_CML (7Eh) Byte 19 Temperature Status Byte STATUS_TEMPERATURE (7Dh) Byte 18 Input Status Byte STATUS_INPUT (7Ch) Byte 17 IOUT Status Byte STATUS_IOUT (7Bh) Byte 16 VOUT Status Byte STATUS_VOUT (7Ah) Byte 15:14 Switching Frequency READ_FREQUENCY (95h) L11 13:12 Reserved Reserved 00h 11:10 Internal Temperature READ_INTERNAL_TEMP (8Dh) L11 Duty Cycle READ_DUTY_CYCLE (94h) L11 9:8 7:6 Reserved Reserved L11 5:4 Output Current READ_IOUT (8Ch) L11 3:2 Output Voltage READ_VOUT (8Bh) L16u 1:0 Input Voltage READ_VIN (88h) L11 SNAPSHOT_CONTROL (F3h) Definition: Writing a 01h causes the device to copy the current Snapshot values from NVRAM to the 32-byte Snapshot command parameter. Writing a 02h causes the device to write the current Snapshot values to NVRAM. Writing a 03h erases all Snapshot values from NVRAM. Write (02h) and Erase (03h) can only be used when the device is disabled. All other values are ignored. Data Length in Bytes: 1 Data Format: Bit field Type: R/W byte Value Description 01h Read Snapshot values from NV RAM 02h Write Snapshot values to NV RAM 03h Erase Snapshot values stored in NV RAM. FN9352 Rev.1.00 May 31, 2019 Page 55 of 64 RAA210925 8. 8. Revision History Revision History 8.1 Firmware Table 12. RAA210925 Nomenclature Guide Firmware Revision Code RAA210925-0-G0100 8.2 Change Description Note Initial Release Recommended for new designs Datasheet Rev. Date 1.00 May 31, 2019 Pin Description table on page 11 and 12 - updated Description for D5 and G14. Page 22, SMBus Communications 1st sentence: Changed PMBus to SMBus page 41 OPERATION (01h) table, 80h removed Nominal from Actions column. 0.00 Sep 12, 2018 Initial release FN9352 Rev.1.00 May 31, 2019 Description Page 56 of 64 Package Outline Drawing For the most recent package outline drawing, see Y58.18x23. Y58.18x23 58 I/O 18mmx23mmx7.5mm Custom HDA Module Rev 4, 4/18 18.00 A Datum A B 181716151413121110 9 8 7 6 5 4 3 2 1 Terminal #A1 Index Area (9x11.5) 12.00 23.00 0.10 M C A B 22.60 0.15 0.10 C 2X 0.40 Ref A B C D E F G H J K L M N P R T U V W Y AA AB AC Pin A1 Indicator C = 0.35 See Detail A RAA210925 FN9352 Rev.1.00 May 31, 2019 9. Datum B 16.00 0.10 C 2X 17.20 Top View 0.10 M C A B Bottom View 0.10 C 7.50 Max 7.30 Min 2 0.20 Ref 1.00 0.20 Ref Seating Plane 0.08 C C Max 0.025 Notes: Page 57 of 64 1. All dimensions are in millimeters. 3 42x0.60 0.05 2. Represents the basic land grid pitch. 42x0.60 0.05 3. These 42 I/Os are centered in a fixed row and column matrix at 1.0mm pitch BSC. 3 4. Dimensioning and tolerancing per ASME Y14.5-2009. 5. Tolerance for exposed PAD edge location dimension on page 3 is 0.1mm. 0.10 M C A B 0.05 M C Terminal Tip 0.100 R Ref 1.00 Detail A 2 9. Package Outline Drawing Side View 1.60 (2X) 4.80 (2X) 8.70 2.60 7.30 6.50 5.50 4.70 4.40 3.50 (2X) 4.60 1.00 (2X) 2.30 2.20 1.10 (2X) 2.70 3.30 4.00 8.20 8.80 6.80 7.20 7.80 5.80 6.20 4.20 4.80 5.20 3.20 3.80 2.20 2.80 0.50 1.20 1.80 0.80 0.20 2.80 2.20 1.80 1.20 0.50 0.20 0.80 4.20 3.80 3.20 5.20 4.80 6.20 7.70 7.30 6.70 6.50 6.30 5.70 5.50 5.30 4.70 6.70 6.30 5.70 5.30 4.30 4.30 3.70 2.00 1.30 0.70 1.00 1.30 2.30 2.30 2.90 2.90 4.00 5.10 4.20 2.10 (2X) 0.70 0.00 0.30 1.10 4.40 9.30 9.10 7.70 2.30 1.70 1.70 3.40 3.60 9.70 2.00 0.70 1.60 (2X) 11.30 9.70 9.30 9.10 3.30 0.30 1.30 11.30 3.70 2.70 1.30 5.80 7.80 1.00 (2X) 7.20 8.80 1.00 (2X) RAA210925 FN9352 Rev.1.00 May 31, 2019 8.30 (2X) 6.00 6.00 8.10 8.10 9.30 9.30 6.30 0.80 (2X) 5.30 (2X) 5.00 (2X) 9.70 8.50 9.70 2.00 (2X) 1.60 (2X) 11.30 11.30 6.00 6.50 4.40 2.40 1.80 0.00 0.80 3.00 6.20 7.40 4.60 5.60 2.20 6.60 4.00 (2X) 7.20 1.40 (2X) Size Details for the 16 Exposed Pads Terminal and Pad Edge Details Bottom View Page 58 of 64 Pad Details 8.60 6.40 5.20 3.60 2.00 0.20 0.40 1.20 2.60 3.80 5.40 7.00 0.60 9. Package Outline Drawing 6.40 8.60 5.60 9.000 5.785 5.215 4.785 4.215 3.785 3.215 2.785 2.215 1.785 1.215 0.785 0.215 0.000 0.215 0.785 1.215 1.785 2.215 2.785 3.215 3.785 4.215 4.785 5.215 5.785 6.215 6.785 9.000 7.785 7.215 6.785 6.215 1.390 1.710 2.500 2.820 3.895 4.215 5.290 5.610 6.400 6.720 7.510 7.830 8.770 9.000 9.000 8.770 8.450 7.830 7.510 6.720 6.400 5.610 5.290 4.215 3.895 2.820 2.500 1.710 1.390 0.530 0.000 0.530 11.500 11.270 9.730 9.410 9.730 9.410 8.130 7.810 8.130 7.810 6.530 6.530 5.470 5.470 3.910 3.590 3.910 3.590 2.030 2.030 0.000 0.000 11.500 11.500 9.285 8.715 8.285 7.715 7.285 6.715 6.285 5.715 5.285 4.715 4.285 3.715 3.285 2.715 2.285 1.715 1.285 0.715 0.285 0.000 0.285 0.715 1.285 1.715 2.285 2.715 3.285 9.285 8.715 8.285 7.715 7.285 6.715 6.285 5.715 5.285 4.715 4.285 3.715 1.285 0.715 0.285 0.000 0.285 0.715 1.285 2.715 3.285 11.500 Page 59 of 64 Stencil Position 1 and 2 9.000 6.215 6.785 7.215 7.785 0.000 1.215 1.785 1.785 1.215 4.785 4.215 3.785 3.215 Stencil Opening Edge Position - 2 9. Package Outline Drawing Stencil Opening Edge Position - 1 9.000 8.785 8.215 11.500 9.000 7.790 8.110 9.490 9.730 9.810 11.270 11.500 0.000 0.230 0.770 1.230 1.910 2.230 2.910 3.230 3.910 4.230 4.910 5.230 5.910 6.230 6.910 6.330 7.510 7.830 8.640 8.960 9.730 9.770 10.090 11.270 11.500 7.660 7.340 6.430 5.970 5.240 4.920 4.190 3.870 3.140 2.820 2.090 6.330 9.000 8.570 RAA210925 FN9352 Rev.1.00 May 31, 2019 11.500 11.270 9.000 7.170 6.230 0.000 6.230 7.170 9.000 2.770 1.875 1.555 0.660 0.340 0.000 0.555 0.875 1.770 9.000 9.000 11.500 11.500 9.070 9.070 6.670 5.825 5.505 4.660 4.340 3.495 3.175 2.330 0.000 0.000 7.960 7.960 7.640 6.530 7.640 6.530 0.000 0.000 2.930 3.840 4.030 4.160 5.070 2.930 3.840 4.160 5.070 6.030 6.890 7.210 8.070 6.030 6.705 6.330 8.530 9.270 11.500 11.500 7.700 Stencil Opening Edge Position - 3 8.570 9.000 6.970 7.230 3.770 4.090 4.570 5.430 1.840 2.160 0.000 0.230 3.430 3.110 2.430 8.570 7.060 6.740 6.110 5.430 5.230 5.110 4.430 4.110 Stencil Opening Edge Position - 4 Page 60 of 64 Stencil Position 3 and 4 7.025 8.020 9.280 9.600 10.275 10.595 11.270 11.500 9.000 9.000 6.570 4.890 5.570 5.890 0.000 1.160 1.670 1.990 2.570 2.890 3.570 3.890 4.570 5.970 5.240 4.920 4.430 4.190 3.870 3.140 2.820 2.090 7.640 7.960 8.530 9.270 9. Package Outline Drawing 9.000 11.500 RAA210925 FN9352 Rev.1.00 May 31, 2019 11.500 11.500 5.320 5.580 6.430 6.690 7.540 7.800 8.800 9.000 3.925 4.185 4.185 3.925 2.790 2.530 1.680 1.420 0.500 0.000 0.500 1.420 1.680 2.530 2.790 9.000 8.800 8.450 7.800 7.540 6.690 6.430 5.580 5.320 9.000 0.000 9.000 0.000 0.000 RAA210925 FN9352 Rev.1.00 May 31, 2019 11.500 11.500 11.500 11.300 11.500 10.950 9.700 9.440 9.700 9.440 8.100 7.840 8.100 7.840 6.500 6.500 5.500 5.500 3.880 3.620 3.880 3.620 2.000 2.000 0.000 0.000 1.030 2.270 4.030 5.070 9.000 3.760 4.080 4.810 5.130 5.860 6.180 6.910 3.030 0.000 1.770 0.430 2.030 3.570 4.910 4.430 6.530 7.810 7.490 7.820 8.080 9.520 9.700 9.780 Stencil Opening Edge Position - 5 11.300 11.500 PCB Land Pattern - 1 (for Reference) Page 61 of 64 Stencil Position5 land pattern 1 9. Package Outline Drawing 9.000 8.770 11.500 7.540 7.800 8.670 8.930 9.700 9.800 10.060 11.300 11.500 9.000 9.280 9.600 10.275 10.595 11.270 11.500 6.300 0.000 0.200 0.800 1.200 1.940 2.200 2.940 3.200 3.940 4.200 4.940 5.200 5.940 6.200 6.940 8.070 6.300 7.630 7.370 6.400 6.000 5.210 4.950 4.160 3.900 3.110 2.850 2.060 6.030 6.890 7.210 9.000 8.600 6.030 6.705 7.025 7.700 8.020 11.500 9.300 8.700 8.300 7.700 7.300 6.700 6.300 5.700 5.300 4.700 4.300 3.700 3.300 2.700 2.300 1.700 1.300 0.700 0.300 0.000 0.300 0.700 1.300 1.700 2.300 2.700 3.300 9.300 8.700 8.300 7.700 7.300 6.700 6.300 5.700 5.300 4.700 4.300 3.700 1.300 0.700 0.300 0.000 0.300 0.700 1.300 2.700 3.300 9.000 2.800 1.845 1.585 0.630 0.370 0.000 0.585 0.845 1.800 9.000 0.000 9.000 6.800 6.200 5.800 5.200 4.800 4.200 3.800 3.200 2.800 2.200 1.800 1.200 0.800 0.200 0.200 0.800 1.200 1.800 2.200 2.800 3.200 3.800 4.200 4.800 5.200 5.800 6.200 6.800 8.800 8.200 7.800 7.200 9.000 RAA210925 FN9352 Rev.1.00 May 31, 2019 11.500 11.500 11.500 6.700 5.795 5.535 4.630 4.370 3.465 3.205 2.300 0.000 0.000 6.000 6.920 7.180 8.100 6.300 7.670 7.930 8.500 9.300 PCB Land Pattern - 3 (for Reference) Page 62 of 64 Land Pattern - 2 and 3 9.000 0.000 1.060 1.700 1.960 2.600 2.860 3.600 3.860 4.600 4.860 5.600 5.860 6.600 6.000 5.210 4.950 4.160 3.900 3.110 2.850 2.060 9.000 9.000 6.200 6.800 7.200 7.800 3.200 3.800 4.200 4.800 0.000 0.200 0.800 1.200 1.800 1.800 1.200 PCB Land Pattern - 2 (for Reference) 11.500 11.500 9. Package Outline Drawing 4.800 4.200 3.800 3.200 11.500 9.000 11.500 9.100 9.100 7.930 7.670 7.930 7.670 6.500 6.500 11.500 11.500 0.000 0.000 9.000 0.000 9.000 7.200 6.200 0.000 6.200 7.200 9.000 11.500 RAA210925 FN9352 Rev.1.00 May 31, 2019 11.500 0.000 0.000 1.000 9.310 9.570 10.305 10.565 11.300 11.500 9.310 9.570 10.305 10.565 11.300 11.500 8.100 PCB Land Pattern - 5 (for Reference) Page 63 of 64 Land Pattern - 4 and 5 9.000 3.000 3.790 4.050 4.840 5.100 5.890 6.150 6.940 0.400 0.000 11.500 9. Package Outline Drawing PCB Land Pattern - 4 (for Reference) 6.000 6.920 7.180 2.000 1.800 8.600 9.000 7.000 7.200 3.800 4.060 4.600 5.400 1.870 2.130 0.000 0.200 7.030 6.770 6.140 5.400 5.200 5.140 4.400 4.140 3.400 3.140 2.400 9.000 8.600 11.500 6.000 6.735 6.995 7.730 7.990 5.100 3.600 9.300 6.000 6.735 6.995 7.730 7.990 4.940 4.400 8.500 4.000 6.500 3.870 4.130 5.100 2.300 2.900 3.870 4.000 4.130 5.100 9.000 8.800 7.780 7.520 2.900 1RWLFH 'HVFULSWLRQVRIFLUFXLWVVRIWZDUHDQGRWKHUUHODWHGLQIRUPDWLRQLQWKLVGRFXPHQWDUHSURYLGHGRQO\WRLOOXVWUDWHWKHRSHUDWLRQRIVHPLFRQGXFWRUSURGXFWV DQGDSSOLFDWLRQH[DPSOHV<RXDUHIXOO\UHVSRQVLEOHIRUWKHLQFRUSRUDWLRQRUDQ\RWKHUXVHRIWKHFLUFXLWVVRIWZDUHDQGLQIRUPDWLRQLQWKHGHVLJQRI\RXU SURGXFWRUV\VWHP5HQHVDV(OHFWURQLFVGLVFODLPVDQ\DQGDOOOLDELOLW\IRUDQ\ORVVHVDQGGDPDJHVLQFXUUHGE\\RXRUWKLUGSDUWLHVDULVLQJIURPWKHXVHRI WKHVHFLUFXLWVVRIWZDUHRULQIRUPDWLRQ 5HQHVDV(OHFWURQLFVKHUHE\H[SUHVVO\GLVFODLPVDQ\ZDUUDQWLHVDJDLQVWDQGOLDELOLW\IRULQIULQJHPHQWRUDQ\RWKHUFODLPVLQYROYLQJSDWHQWVFRS\ULJKWVRU RWKHULQWHOOHFWXDOSURSHUW\ULJKWVRIWKLUGSDUWLHVE\RUDULVLQJIURPWKHXVHRI5HQHVDV(OHFWURQLFVSURGXFWVRUWHFKQLFDOLQIRUPDWLRQGHVFULEHGLQWKLV GRFXPHQWLQFOXGLQJEXWQRWOLPLWHGWRWKHSURGXFWGDWDGUDZLQJVFKDUWVSURJUDPVDOJRULWKPVDQGDSSOLFDWLRQH[DPSOHV 1ROLFHQVHH[SUHVVLPSOLHGRURWKHUZLVHLVJUDQWHGKHUHE\XQGHUDQ\SDWHQWVFRS\ULJKWVRURWKHULQWHOOHFWXDOSURSHUW\ULJKWVRI5HQHVDV(OHFWURQLFVRU RWKHUV <RXVKDOOQRWDOWHUPRGLI\FRS\RUUHYHUVHHQJLQHHUDQ\5HQHVDV(OHFWURQLFVSURGXFWZKHWKHULQZKROHRULQSDUW5HQHVDV(OHFWURQLFVGLVFODLPVDQ\ DQGDOOOLDELOLW\IRUDQ\ORVVHVRUGDPDJHVLQFXUUHGE\\RXRUWKLUGSDUWLHVDULVLQJIURPVXFKDOWHUDWLRQPRGLILFDWLRQFRS\LQJRUUHYHUVHHQJLQHHULQJ 5HQHVDV(OHFWURQLFVSURGXFWVDUHFODVVLILHGDFFRUGLQJWRWKHIROORZLQJWZRTXDOLW\JUDGHV6WDQGDUGDQG+LJK4XDOLW\7KHLQWHQGHGDSSOLFDWLRQVIRU HDFK5HQHVDV(OHFWURQLFVSURGXFWGHSHQGVRQWKHSURGXFW VTXDOLW\JUDGHDVLQGLFDWHGEHORZ 6WDQGDUG &RPSXWHUVRIILFHHTXLSPHQWFRPPXQLFDWLRQVHTXLSPHQWWHVWDQGPHDVXUHPHQWHTXLSPHQWDXGLRDQGYLVXDOHTXLSPHQWKRPH HOHFWURQLFDSSOLDQFHVPDFKLQHWRROVSHUVRQDOHOHFWURQLFHTXLSPHQWLQGXVWULDOURERWVHWF +LJK4XDOLW\ 7UDQVSRUWDWLRQHTXLSPHQWDXWRPRELOHVWUDLQVVKLSVHWF WUDIILFFRQWUROWUDIILFOLJKWV ODUJHVFDOHFRPPXQLFDWLRQHTXLSPHQWNH\ ILQDQFLDOWHUPLQDOV\VWHPVVDIHW\FRQWUROHTXLSPHQWHWF 8QOHVVH[SUHVVO\GHVLJQDWHGDVDKLJKUHOLDELOLW\SURGXFWRUDSURGXFWIRUKDUVKHQYLURQPHQWVLQD5HQHVDV(OHFWURQLFVGDWDVKHHWRURWKHU5HQHVDV (OHFWURQLFVGRFXPHQW5HQHVDV(OHFWURQLFVSURGXFWVDUHQRWLQWHQGHGRUDXWKRUL]HGIRUXVHLQSURGXFWVRUV\VWHPVWKDWPD\SRVHDGLUHFWWKUHDWWR KXPDQOLIHRUERGLO\LQMXU\DUWLILFLDOOLIHVXSSRUWGHYLFHVRUV\VWHPVVXUJLFDOLPSODQWDWLRQVHWF RUPD\FDXVHVHULRXVSURSHUW\GDPDJHVSDFHV\VWHP XQGHUVHDUHSHDWHUVQXFOHDUSRZHUFRQWUROV\VWHPVDLUFUDIWFRQWUROV\VWHPVNH\SODQWV\VWHPVPLOLWDU\HTXLSPHQWHWF 5HQHVDV(OHFWURQLFVGLVFODLPV DQ\DQGDOOOLDELOLW\IRUDQ\GDPDJHVRUORVVHVLQFXUUHGE\\RXRUDQ\WKLUGSDUWLHVDULVLQJIURPWKHXVHRIDQ\5HQHVDV(OHFWURQLFVSURGXFWWKDWLV LQFRQVLVWHQWZLWKDQ\5HQHVDV(OHFWURQLFVGDWDVKHHWXVHU VPDQXDORURWKHU5HQHVDV(OHFWURQLFVGRFXPHQW :KHQXVLQJ5HQHVDV(OHFWURQLFVSURGXFWVUHIHUWRWKHODWHVWSURGXFWLQIRUPDWLRQGDWDVKHHWVXVHU VPDQXDOVDSSOLFDWLRQQRWHV*HQHUDO1RWHVIRU +DQGOLQJDQG8VLQJ6HPLFRQGXFWRU'HYLFHVLQWKHUHOLDELOLW\KDQGERRNHWF DQGHQVXUHWKDWXVDJHFRQGLWLRQVDUHZLWKLQWKHUDQJHVVSHFLILHGE\ 5HQHVDV(OHFWURQLFVZLWKUHVSHFWWRPD[LPXPUDWLQJVRSHUDWLQJSRZHUVXSSO\YROWDJHUDQJHKHDWGLVVLSDWLRQFKDUDFWHULVWLFVLQVWDOODWLRQHWF5HQHVDV (OHFWURQLFVGLVFODLPVDQ\DQGDOOOLDELOLW\IRUDQ\PDOIXQFWLRQVIDLOXUHRUDFFLGHQWDULVLQJRXWRIWKHXVHRI5HQHVDV(OHFWURQLFVSURGXFWVRXWVLGHRIVXFK VSHFLILHGUDQJHV $OWKRXJK5HQHVDV(OHFWURQLFVHQGHDYRUVWRLPSURYHWKHTXDOLW\DQGUHOLDELOLW\RI5HQHVDV(OHFWURQLFVSURGXFWVVHPLFRQGXFWRUSURGXFWVKDYHVSHFLILF FKDUDFWHULVWLFVVXFKDVWKHRFFXUUHQFHRIIDLOXUHDWDFHUWDLQUDWHDQGPDOIXQFWLRQVXQGHUFHUWDLQXVHFRQGLWLRQV8QOHVVGHVLJQDWHGDVDKLJKUHOLDELOLW\ SURGXFWRUDSURGXFWIRUKDUVKHQYLURQPHQWVLQD5HQHVDV(OHFWURQLFVGDWDVKHHWRURWKHU5HQHVDV(OHFWURQLFVGRFXPHQW5HQHVDV(OHFWURQLFVSURGXFWV DUHQRWVXEMHFWWRUDGLDWLRQUHVLVWDQFHGHVLJQ<RXDUHUHVSRQVLEOHIRULPSOHPHQWLQJVDIHW\PHDVXUHVWRJXDUGDJDLQVWWKHSRVVLELOLW\RIERGLO\LQMXU\ LQMXU\RUGDPDJHFDXVHGE\ILUHDQGRUGDQJHUWRWKHSXEOLFLQWKHHYHQWRIDIDLOXUHRUPDOIXQFWLRQRI5HQHVDV(OHFWURQLFVSURGXFWVVXFKDVVDIHW\ GHVLJQIRUKDUGZDUHDQGVRIWZDUHLQFOXGLQJEXWQRWOLPLWHGWRUHGXQGDQF\ILUHFRQWURODQGPDOIXQFWLRQSUHYHQWLRQDSSURSULDWHWUHDWPHQWIRUDJLQJ GHJUDGDWLRQRUDQ\RWKHUDSSURSULDWHPHDVXUHV%HFDXVHWKHHYDOXDWLRQRIPLFURFRPSXWHUVRIWZDUHDORQHLVYHU\GLIILFXOWDQGLPSUDFWLFDO\RXDUH UHVSRQVLEOHIRUHYDOXDWLQJWKHVDIHW\RIWKHILQDOSURGXFWVRUV\VWHPVPDQXIDFWXUHGE\\RX 3OHDVHFRQWDFWD5HQHVDV(OHFWURQLFVVDOHVRIILFHIRUGHWDLOVDVWRHQYLURQPHQWDOPDWWHUVVXFKDVWKHHQYLURQPHQWDOFRPSDWLELOLW\RIHDFK5HQHVDV (OHFWURQLFVSURGXFW<RXDUHUHVSRQVLEOHIRUFDUHIXOO\DQGVXIILFLHQWO\LQYHVWLJDWLQJDSSOLFDEOHODZVDQGUHJXODWLRQVWKDWUHJXODWHWKHLQFOXVLRQRUXVHRI FRQWUROOHGVXEVWDQFHVLQFOXGLQJZLWKRXWOLPLWDWLRQWKH(85R+6'LUHFWLYHDQGXVLQJ5HQHVDV(OHFWURQLFVSURGXFWVLQFRPSOLDQFHZLWKDOOWKHVH DSSOLFDEOHODZVDQGUHJXODWLRQV5HQHVDV(OHFWURQLFVGLVFODLPVDQ\DQGDOOOLDELOLW\IRUGDPDJHVRUORVVHVRFFXUULQJDVDUHVXOWRI\RXUQRQFRPSOLDQFH ZLWKDSSOLFDEOHODZVDQGUHJXODWLRQV 5HQHVDV(OHFWURQLFVSURGXFWVDQGWHFKQRORJLHVVKDOOQRWEHXVHGIRURULQFRUSRUDWHGLQWRDQ\SURGXFWVRUV\VWHPVZKRVHPDQXIDFWXUHXVHRUVDOHLV SURKLELWHGXQGHUDQ\DSSOLFDEOHGRPHVWLFRUIRUHLJQODZVRUUHJXODWLRQV<RXVKDOOFRPSO\ZLWKDQ\DSSOLFDEOHH[SRUWFRQWUROODZVDQGUHJXODWLRQV SURPXOJDWHGDQGDGPLQLVWHUHGE\WKHJRYHUQPHQWVRIDQ\FRXQWULHVDVVHUWLQJMXULVGLFWLRQRYHUWKHSDUWLHVRUWUDQVDFWLRQV ,WLVWKHUHVSRQVLELOLW\RIWKHEX\HURUGLVWULEXWRURI5HQHVDV(OHFWURQLFVSURGXFWVRUDQ\RWKHUSDUW\ZKRGLVWULEXWHVGLVSRVHVRIRURWKHUZLVHVHOOVRU WUDQVIHUVWKHSURGXFWWRDWKLUGSDUW\WRQRWLI\VXFKWKLUGSDUW\LQDGYDQFHRIWKHFRQWHQWVDQGFRQGLWLRQVVHWIRUWKLQWKLVGRFXPHQW 7KLVGRFXPHQWVKDOOQRWEHUHSULQWHGUHSURGXFHGRUGXSOLFDWHGLQDQ\IRUPLQZKROHRULQSDUWZLWKRXWSULRUZULWWHQFRQVHQWRI5HQHVDV(OHFWURQLFV 3OHDVHFRQWDFWD5HQHVDV(OHFWURQLFVVDOHVRIILFHLI\RXKDYHDQ\TXHVWLRQVUHJDUGLQJWKHLQIRUPDWLRQFRQWDLQHGLQWKLVGRFXPHQWRU5HQHVDV (OHFWURQLFVSURGXFWV 1RWH 1RWH 5HQHVDV(OHFWURQLFVDVXVHGLQWKLVGRFXPHQWPHDQV5HQHVDV(OHFWURQLFV&RUSRUDWLRQDQGDOVRLQFOXGHVLWVGLUHFWO\RULQGLUHFWO\FRQWUROOHG VXEVLGLDULHV 5HQHVDV(OHFWURQLFVSURGXFWV PHDQVDQ\SURGXFWGHYHORSHGRUPDQXIDFWXUHGE\RUIRU5HQHVDV(OHFWURQLFV 5HY1RYHPEHU &RUSRUDWH+HDGTXDUWHUV &RQWDFW,QIRUPDWLRQ 72<268)25(6,$7R\RVX .RWRNX7RN\R-DSDQ TOYOSU FORESIA, 3-2-24 Toyosu, )RUIXUWKHULQIRUPDWLRQRQDSURGXFWWHFKQRORJ\WKHPRVWXSWRGDWH YHUVLRQRIDGRFXPHQWRU\RXUQHDUHVWVDOHVRIILFHSOHDVHYLVLW For further information on a product, technology, the most up-to-date Koto-ku, Tokyo 135-0061, Japan ZZZUHQHVDVFRP version of a document, or your nearest sales office, please visit: ZZZUHQHVDVFRPFRQWDFW Corporate Headquarters www.renesas.com Contact Information www.renesas.com/contact/ 7UDGHPDUNV Trademarks 5HQHVDVDQGWKH5HQHVDVORJRDUHWUDGHPDUNVRI5HQHVDV(OHFWURQLFV &RUSRUDWLRQ$OOWUDGHPDUNVDQGUHJLVWHUHGWUDGHPDUNVDUHWKHSURSHUW\ Renesas and the Renesas logo are trademarks of Renesas Electronics RIWKHLUUHVSHFWLYHRZQHUV Corporation. All trademarks and registered trademarks are the property of their respective owners. 5HQHVDV(OHFWURQLFV&RUSRUDWLRQ$OOULJKWVUHVHUYHG